KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1794Help
Entry
CBUD_1794         CDS       T00583                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1787041..1787601)
Genome map
AA seq 186 aa AA seqDB search
MTIAYVGVGANLDNPLKQVQIAVSNLSTLPQTACLGYSSFYRSKPLGPTDQPDYINAVAA
VETTLSPQMLLKALQRLEEKQGRCRGGKRWGPRIIDLDILLYGDLALQSDELCLPHPGLF
VREFVLYPLAEVAEDLILPGGESILELKAKCPDRGIERIIKNPSSLLPFPFRGKGLEKEG
DTKALA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcctatgttggcgtaggggcaaacctggataatccgctcaagcaagtgcaa
atcgcggtaagtaatttgtccacgttgccgcaaactgcttgtcttggctattccagcttt
tatcggagcaaaccgttgggcccgactgatcaaccggattacatcaacgccgtagcagcg
gttgaaactaccttgtccccccaaatgcttttgaaagcattgcaacgactcgaagaaaaa
caaggccggtgtcggggcgggaaacgatgggggccgcggattatcgatctcgatatttta
ttgtatggagatcttgcgcttcagagcgatgagctttgtcttccccatccgggacttttt
gtgcgggaatttgtgctttatccactggctgaagtcgcagaagacttgattttacccggc
ggcgagtctattttggaactgaaagcaaaatgccctgatcgaggcattgaacgaattata
aaaaacccctcttcactacttccttttccctttagggggaaagggttggagaaagagggt
gatacaaaggcgctagcatga

DBGET integrated database retrieval system