KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1983Help
Entry
CBUD_1983         CDS       T00583                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cbd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cbd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1962354..1963823)
Genome map
AA seq 489 aa AA seqDB search
MNGKYLSQLLDAKNKALTADVLIKALQTDSRKIQPGDLFIAYPGLQVDGRDYIKEALDKK
AAAVFYEANQYNPSIQTKVPLIPFENLQHRIGEIAARFYDDPSCEMEIIGITGTNGKTSC
AQFIAQALQSQGIRCGVIGTLGYGFLGSLHKTSHTTPEPIQLQQAFAEMRKQGAKAIAME
VSSHALHQRRVEGVQFDIAVFTQLSRDHLDYHGDMENYARAKELLFQQPGLHTGVVNCDD
ALGKRIIAHYRHQLTLVGYSANGVKDDRVSSVIASAIQPLAQGFSVEVQTPWGEGTFTTP
LFGRFNISNLLAVLSVLCLCEIPFDKALLELSQLRNVPGRMQVVDSQRQPQIIVDYAHTP
DALEKALTALREHCQGRLICVFGCGGDRDRGKRPQMAAVAEQHADQIILTNDNPRTESPL
TIIQDIQAGFKNKNAVLVKLDRAEAIRYAVQMAAVNDIVLIAGKGHETTQTIADQVLPFN
DVEEAKKAL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaatacctgagtcagctattagacgctaaaaataaggcgctaacggccgat
gtattaatcaaagcccttcaaacagacagccggaaaatacagcctggcgatctttttatc
gcttatccaggattgcaggtggatggacgggattatattaaagaagcgttggataaaaaa
gcggcggcggtgttttacgaggctaatcaatataatccttcgattcaaaccaaagttccc
ttaattccctttgaaaatttacaacatcgcattggcgaaattgccgcccgattttatgac
gatccctcatgcgaaatggaaatcatcggtatcacgggcaccaatgggaaaacttcctgc
gcccaattcattgcgcaagccttgcaatctcaaggaatccgttgtggcgttataggcacc
ttgggttacggctttttggggagtttacacaaaacctctcacaccactcccgaacccatc
caattgcaacaagccttcgccgaaatgcgaaaacaaggtgccaaagcaattgcaatggaa
gtttcctcgcacgcactgcatcagcggcgagtggaaggcgtgcaatttgacatcgctgta
tttacccaattatcgcgcgaccatttggattaccacggtgacatggaaaattacgcgcgt
gcgaaagaattattattccaacagccgggattgcacactggcgtagtaaattgtgatgac
gctttaggaaaacgcatcatcgctcattatcgtcatcaattaactttagtgggttattcc
gctaacggagtgaaagacgaccgagtttcttctgtgattgccagtgctattcaaccttta
gcacaaggattttcggtggaggttcaaactccttggggggaaggcactttcaccacacct
ttgttcggtcggtttaatatcagcaatttgttagcggttttgagcgtgttgtgtctgtgt
gaaattcccttcgacaaagcgctgctcgaattatctcaattgcgtaatgtacccgggcgc
atgcaggtggtggatagtcagcgtcaaccccagattattgtcgattacgcccatactccc
gatgccctggaaaaagcgctaaccgctttacgcgaacattgtcagggccgattaatttgt
gtttttggttgtgggggcgatcgtgatcgcggcaaacgaccacaaatggctgccgttgcc
gagcaacacgccgatcaaattattttaacgaacgacaatccgcgtacggaatcgccttta
accattattcaagatatacaagcgggtttcaaaaataaaaatgcagtgcttgtaaaattg
gatcgtgccgaagcgatccgctatgccgtgcaaatggcggcggttaatgatatcgttctg
attgctggcaaagggcacgaaaccacgcagaccatcgcagatcaggtactgccttttaat
gacgtcgaggaagctaaaaaagcgttatga

DBGET integrated database retrieval system