KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0024Help
Entry
Cbei_0024         CDS       T00547                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00330  Arginine and proline metabolism
cbe00332  Carbapenem biosynthesis
cbe01100  Metabolic pathways
cbe01130  Biosynthesis of antibiotics
cbe01230  Biosynthesis of amino acids
Module
cbe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cbei_0024
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cbei_0024
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cbei_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PCI
Motif
Other DBs
NCBI-ProteinID: ABR32214
JGI: Cbei0024
UniProt: A6LPD4
Position
36010..36813
Genome map
AA seq 267 aa AA seqDB search
MGFRQRLKDASRIVVKVGSSTLTYDNGNINLSRIEKLTRVLSDVVNSGKQVTLVTSGAVA
VGVNKLKLKEKPESIREKQAVAAVGQCELMHIYSKFFGEYSHVVGQVLLTRDVVEDDHIR
ENVCNTFETLLDNNIIPIVNENDTVSIDEIENIVRFGDNDNLSAIVASLINADLLIILSD
IDGFYDSDPRNNESAKLLNEVREITPELEECAGGAGSNLGTGGMITKLSAAKTSTKAGVD
MILANGSEPDIIIDILKGEEIGTLFVS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgggctttcgtcaaaggttaaaagatgctagtagaatagtagtaaaggttggatcatca
acattaacttatgataatggaaatattaatttaagtagaattgaaaagctaacgcgcgta
ttatctgatgtagttaattcaggtaagcaggttacgcttgttacatcaggtgcagttgct
gttggtgttaataaattaaaattgaaagaaaagcccgaaagtataagagaaaagcaagca
gtagcagcagttggacaatgcgaactaatgcatatatatagtaaattttttggagaatat
agccatgtggttgggcaagtgttactcacaagagatgtagtagaagatgatcatattagg
gaaaatgtatgcaatacatttgaaactttattagataataatataattcctatagtaaat
gagaatgatacagtttcaatagatgaaattgagaatatagttagatttggtgataatgat
aatttatcggcaatagttgcatcattaattaacgcagatttgttaataattttatctgat
atagatgggttctatgattcagacccaaggaataatgagagtgcaaaattactaaatgaa
gttagagaaataactcctgagttagaagagtgcgctggaggtgcaggatcaaatctagga
actggtggaatgatcacaaaattatcagcagctaagacatccacaaaagcaggagtagat
atgattttagcgaatggaagtgaaccagatataataatagatattttgaagggtgaagaa
ataggaactttatttgtatcgtag

DBGET integrated database retrieval system