KEGG   Clostridium beijerinckii: Cbei_0206Help
Entry
Cbei_0206         CDS       T00547                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cbe  Clostridium beijerinckii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
234782..235591
Genome map
AA seq 269 aa AA seqDB search
MKIGSKEFNIGERTYIMGILNFTPDSFSDGGKFNDIDVAVKHVKEMIDNGADIIDVGGES
TRPGYEIVSEEEEISRVVPIIKAIKEDFDIPVSIDTYKAKVAEQAIEAGANLINDIWGFK
KDKDMAKVAAKYNVPCCLMHNRDNTEYKNLMEDILNDLKECINIAKDAGVKDENIILDPG
IGFGKTYEQNLEAMNNLERIKELGYPILLGTSRKSMIGLALNLPVEERIEGTVATTVIGI
MKDACDFVRVHDVLENSRAAKMTDIIVRR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggaagtaaggaatttaatataggggaaagaacatatattatgggaatatta
aattttacgccagattctttctcagatggaggaaaatttaatgacattgatgttgctgta
aaacatgtgaaagaaatgatagataacggagctgacataatagatgtaggaggggaatct
acaagaccgggatatgagatagtaagtgaagaagaagaaatttcaagagttgtacctata
ataaaagctataaaagaagattttgatataccagtatcaatagatacatacaaagctaaa
gttgcagagcaagcaatagaagctggtgcgaaccttattaatgatatatggggatttaaa
aaagataaagatatggcaaaagttgcggcaaaatataatgtaccttgttgtctaatgcat
aatagagataatacagagtataaaaatttaatggaagatatattaaatgatttgaaagaa
tgtattaatattgctaaggatgctggagtaaaagatgaaaatataatactagatccaggt
ataggtttcggaaagacctatgaacaaaatttagaagctatgaataacttagaaagaatc
aaagagttgggatatccgatattgcttggcacttccagaaagtctatgataggattagct
cttaatttgcctgtagaggaaagaatagaggggacagttgcaacaacggttattggaata
atgaaagatgcttgtgattttgtaagagttcatgatgtgcttgaaaattcaagagcagca
aagatgactgatataatcgtaagaagatag

DBGET integrated database retrieval system