KEGG   Clostridium beijerinckii: Cbei_0207Help
Entry
Cbei_0207         CDS       T00547                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cbe  Clostridium beijerinckii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
235604..236428
Genome map
AA seq 274 aa AA seqDB search
MDKMYIRELELFGFHGVFEEEKRLGQKFILSFELDIDLKLAGKTGDLTKTVHYGELCEKI
EDEFKRKNYELIETATLNLADFILNEYKIIEGVKVFLKKPWAPIKKHLDTVEIMIERRRH
KAYISLGSNIGNKEQYLEDAINKISAEKNIEIIRKSSFIKTKPWGYLEQEDFLNGVVEIE
TILEAEELMDVLLGIEANLDRKRTIKWGPRTIDLDIIIYDSVVSSNEKVILPHPRMHERE
FVLKPLSEIAPYLMHPVLNKRVFTLLEELEKKDN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttggataagatgtatataagagaattagagttatttggctttcatggagttttcgaagag
gaaaaaagattaggtcaaaagttcattttatcttttgaactagatatagatctaaaatta
gcaggaaaaactggagatttaactaaaacagttcattatggtgaattgtgtgaaaaaata
gaagatgaatttaaaagaaagaactatgagcttatagaaacagcaactttaaatttagct
gattttattcttaatgaatataagataatagaaggtgttaaggtgttcctaaaaaagcct
tgggcccctataaaaaaacatttagatactgtagaaataatgattgaaagaagaaggcac
aaagcatatataagtttaggatctaatattgggaataaagaacaatatttagaggacgca
ataaataaaatatctgcagaaaaaaatattgaaataataagaaagtcatcgtttattaaa
acaaaaccatggggatacttagaacaggaagattttttaaatggtgttgtggaaatagaa
actatattagaagcagaagaacttatggatgtactacttggaatcgaagcaaatctagat
agaaagaggactataaaatggggacctagaactattgatctggatattattatatatgat
tcagtggtttcttcaaatgaaaaggtgattcttccacatccaagaatgcatgagagagaa
tttgtattaaaaccattaagtgaaatagcaccatatcttatgcatcctgtgctcaataag
agagtattcactcttttagaggagttagagaaaaaggacaattaa

DBGET integrated database retrieval system