KEGG   Clostridium beijerinckii: Cbei_0233Help
Entry
Cbei_0233         CDS       T00547                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cbe  Clostridium beijerinckii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cbei_0233
Enzymes [BR:cbe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cbei_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
264114..265604
Genome map
AA seq 496 aa AA seqDB search
MNRSSGIIMHIASLPGKYGIGTFGKEAYKFGDFLKKAGQKYWQILPLGPTSFGDSPYQSF
SAFAGNPYFIDFDILRQDGFLDESDYYSVNFGESSEDIDYGLIFKEKLRVLKIAYEKFKL
RQDKDLIKFQEAEAYWLDDYALYMSIKKHFDLKSWYEWDEDIRLREPEAINRYKILLEDE
IGFWKFLQYEFYKHWNNLKAYINNLGIEIIGDMPIYVAEDSADVWGNPEAFLLNKNTLKP
LKVAGCPPDIFAATGQLWGNPIYDWCYMGKTDYKWWVDRIRQSLNLYDVLRIDHFKGFES
YWSIPYGDLTAENGEWVKGPGIKVFNAIKDELGEVNIIAEDLGTLTEETIKLRNDTGFPG
MKILTFGFDSDSSNPFLPHNYEKNFIVYTGTHDNDTVRGWIEKTAPKEEVQRAITYLGLN
KEEGYNWGFIRGAWSSIANISMAQMQDFLNLGNEARINLPSTLGNNWRWRVRKDALTDQL
AEKIHQITRTYGRCDN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaagtagtggtataataatgcacattgcttctctgccaggaaagtatggaata
gggacatttggtaaagaagcatataaatttggagattttctaaaaaaggcgggtcagaag
tattggcagatactgccgctagggcctacaagttttggagattcaccatatcaatctttc
tcggcatttgctgggaatccatattttatagattttgatattttaagacaggatggattt
ttagatgagagcgattattattcagtgaactttggggaaagttcagaggatatagattat
ggtttgatttttaaagaaaaattaagggtattaaaaatagcatacgaaaaatttaaatta
agacaagataaggatttaattaagtttcaagaagctgaggcctattggcttgatgattat
gcattgtatatgtcaataaaaaaacattttgatttgaagagctggtatgaatgggatgaa
gacattaggttaagagaaccagaggcaataaataggtataaaatcttattagaagatgaa
ataggattttggaagtttttgcaatatgagttctataaacattggaataatttaaaagcc
tatattaataatttgggaattgaaataataggagatatgcctatatatgtggcagaggac
agtgctgatgtatgggggaatcctgaagcattcttacttaataaaaatacactaaaacca
ttaaaagttgctggatgtccaccggatatatttgctgccacaggacaattatggggaaat
ccgatctatgattggtgctatatggggaaaacggactataaatggtgggttgatcgcata
agacaaagtttgaacttatatgatgtacttagaatagatcattttaaaggatttgaatca
tattggtctattccttatggagatctaacagcagaaaatggtgaatgggttaaaggccct
ggaataaaagttttcaatgcaattaaagatgagcttggtgaagttaatataattgcagaa
gatctaggtacacttactgaagaaacaataaagcttagaaatgatacagggtttcctgga
atgaagatattgacatttggatttgattcagatagctcaaatccttttttacctcataac
tatgaaaagaactttatagtttatactggtacacatgataatgatactgtaagaggatgg
attgaaaaaacagcacctaaagaagaagttcaaagagcaataacgtatttaggtctaaat
aaagaagaggggtataactggggatttattaggggtgcttggagcagtatcgcgaatatt
tccatggcacaaatgcaagatttcttgaatttgggaaatgaagccagaattaatttgcct
tcaacattggggaataattggcgttggagagtaaggaaagatgcattgacagatcaatta
gcagaaaaaattcatcagatcactagaacttatggaaggtgtgataattag

DBGET integrated database retrieval system