KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0305Help
Entry
Cbei_0305         CDS       T00547                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cbei_0305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0305
   00620 Pyruvate metabolism
    Cbei_0305
   00650 Butanoate metabolism
    Cbei_0305
  Lipid metabolism
   00071 Fatty acid degradation
    Cbei_0305
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cbei_0305
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cbei_0305
   00626 Naphthalene degradation
    Cbei_0305
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cbei_0305
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cbei_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
363882..366476
Genome map
AA seq 864 aa AA seqDB search
MRVTNPEELTKRIEQIREAQREFAKFSQEEVDEIFRQAAMAANDARITLAKMAVEESGMG
IVEDKVIKNHFAAEYIYNQYKDTKTCGVIERDEMFGITHIAEPIGVIAAIVPTTNPTSTA
IFKTLIALKTRNGIIISPHPRAKNSTIAAAKIVLEAAERAGAPKGIIGWIDEPSIELSRN
VMAESDIILATGGPGMVRAAYSSGKPAIGVGAGNTPAIIDDTAHIKMAVNSILLSKTFDN
GVVCASEQSIIAMESVYDEVLKELDERGAYILRGEEIDKVRSIILDSKGSLNSEIVGQSA
YKIAKMAGVEISEAVKVLIGEVESPELEEPFSHEKLSPILGMYKAKTFDDALRLASRMIE
LGGFGHTSILYTNQMESVDRIEKFGVAMKTARTLINMPASQGAIGDIYNFKLAPSLTLGC
GSWGGNSISENVGPKHLINVKRIAERRENMLWFRVPDKIYFKFGCLPVALEELNAMKKKR
AFIVTDRVLFDLGYTHKITNILSENHIEYKIFSDVEPDPTLKAAKLGADAMRDFNPDVII
AIGGGSPMDAAKIMWVMYEHPDVRFEDLAMRFMDIRKRVYEFPPMGEKAILVAIPTSAGT
GSEVTPFAVITDQQTGVKYPLADYALTPNMAIIDAELMMSMPKGLTAASGIDALVHAIEA
YVSVLASEYTNGLALEAIRLTFKYLPDAYNGGATNIKAREKMAHASSVAGMAFANAFLGI
CHSMAHKLGAFHHVPHGIANALLIDEVIRFNATDAPRKQAAFPQYKYPNAGWRYARIADY
LNLGGNTEEEKVELLIKAIDDLKAKVGIPKSIKEFGVSEEKFYASMDEMVEQAFDDQCTG
ANPRYPLMSEIKDMYIKSYNGSNK
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgagagttacgaatccagaagaattgacaaaaagaatagagcaaataagggaagcccaa
agagaatttgcaaaattttctcaagaagaggtagatgaaatatttaggcaagcagccatg
gcagcgaacgatgcgagaattactcttgctaaaatggcagtagaagaaagcggaatggga
atagtagaagataaggtaataaaaaatcacttcgcagctgagtacatatataaccaatat
aaagatacaaagacctgtggagttatagagagagatgaaatgttcggaataactcatatc
gctgaacctataggggtaatagctgcaatcgtgccaacaacaaatccaacatcaacagcc
atatttaaaacattgattgcattaaagacaaggaacggaataattataagtccacatcct
agggcaaagaattcaacaatagcagccgcaaaaatagttctagaagcagcagaaagagct
ggtgcaccaaaaggaataattggatggatagatgagccatcaatagaattatccagaaac
gttatggcagaatctgatattatactagctacaggtggtcctggaatggttagagctgcg
tattcatcaggaaaaccagctattggagttggagcaggaaatactccagctataattgat
gatacagctcatataaaaatggctgtaaactcgattttgctttctaagacttttgataac
ggggtagtttgtgcatcagaacagagcataatagctatggaatcagtatatgatgaggtt
ctaaaggaattagatgaaagaggagcttatatacttagaggtgaagaaattgataaggtc
agaagtataatattagattcaaagggatctttaaattcagagattgttggtcagtcagct
tacaagattgcaaaaatggctggagtagagatatcagaagctgttaaagtattaataggt
gaagttgaatcacctgaattagaagaaccattttcacatgaaaaattgtcaccaatatta
ggtatgtataaagctaaaacttttgatgatgcgctaagattagcttccagaatgatagaa
ttaggcggatttggtcatacatcaatactttatacaaatcaaatggaatcagtagacaga
atagagaagttcggagtagccatgaagaccgctagaactttaataaatatgcctgcatct
cagggtgcaatcggggatatatataactttaagttagcaccatcattgactcttggctgt
ggatcttggggggggaattcaatatcggaaaatgtaggacctaagcacttaatcaatgtt
aaaagaattgctgagaggagagaaaatatgctttggttcagagttccggataaaatttac
tttaaatttggatgtcttccagttgcgctagaagaattaaatgcaatgaagaagaaaagg
gcgtttatagtaaccgatagggtgctatttgatctaggatacactcataaaattacaaat
attttaagtgaaaatcatattgaatataagatattctcagatgtagaacctgatccaaca
ttaaaggctgcaaagttaggtgcagatgcaatgagagattttaatccagatgttattata
gctataggtggaggatcgcctatggatgctgcaaaaattatgtgggtaatgtatgagcat
ccagatgttagatttgaagacttggcaatgagatttatggatattagaaagagagtatat
gaattccctccaatgggagaaaaggcaattttagttgcaatcccaacatcagcaggaact
ggatcagaagtaactccatttgcagttataacagatcaacaaacaggagttaagtatcca
cttgcagattatgcattgactcctaatatggctataatagatgcagaacttatgatgagc
atgcctaaaggattaacagcggcctctggtatagatgctttagttcatgcaattgaggct
tatgtttcagtgttagcatctgagtatacaaacggattagcgcttgaagcaataagattg
acattcaaatatttaccagatgcatataatggaggagctacaaatattaaagctagagaa
aagatggctcatgcatcttccgtagcagggatggcttttgctaatgcatttttaggtata
tgccactcaatggctcataagctaggtgcattccaccatgtacctcacggaatagcaaat
gcattattaatagatgaagtgattaggtttaatgcaacagatgcgcctagaaagcaagcg
gctttcccacaatataaatacccaaatgcaggatggagatatgctagaatagctgattat
ctaaatctaggaggaaatacagaagaagagaaagttgaattattgattaaagcaatagat
gatttaaaggccaaagttggaattccaaagagcataaaagaatttggagtttcagaagaa
aagttctatgcttcaatggatgaaatggttgagcaggcttttgatgatcaatgtacaggt
gcaaatccaagatatcctttaatgagtgaaattaaagatatgtatataaaatcatataat
ggcagcaataaataa

DBGET integrated database retrieval system