KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0411Help
Entry
Cbei_0411         CDS       T00547                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00071  Fatty acid degradation
cbe00072  Synthesis and degradation of ketone bodies
cbe00280  Valine, leucine and isoleucine degradation
cbe00310  Lysine degradation
cbe00362  Benzoate degradation
cbe00380  Tryptophan metabolism
cbe00620  Pyruvate metabolism
cbe00630  Glyoxylate and dicarboxylate metabolism
cbe00640  Propanoate metabolism
cbe00650  Butanoate metabolism
cbe00900  Terpenoid backbone biosynthesis
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
cbe01212  Fatty acid metabolism
cbe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cbei_0411
   00630 Glyoxylate and dicarboxylate metabolism
    Cbei_0411
   00640 Propanoate metabolism
    Cbei_0411
   00650 Butanoate metabolism
    Cbei_0411
  Lipid metabolism
   00071 Fatty acid degradation
    Cbei_0411
   00072 Synthesis and degradation of ketone bodies
    Cbei_0411
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cbei_0411
   00310 Lysine degradation
    Cbei_0411
   00380 Tryptophan metabolism
    Cbei_0411
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cbei_0411
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cbei_0411
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cbei_0411
Enzymes [BR:cbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Cbei_0411
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cbei_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABR32599
JGI: Cbei0411
UniProt: A6LQG9
Position
499121..500302
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTALGSFGGALKDVSAVDLGALVIKEAVNRAGVKPELIEEVIMGNVIQAG
LGQNTARQSTIKAGLPQEVSAMTINKVCGSGLRAVSLAAQMIKAGDADVVVAGGMENMSA
APYALDKARWGQRMGDGKLVDTMIKDALWDAFNNYHMGVTAENIAKQWGLTREEQDAFSA
ASQQKAEAAIKSGRFKDEIVPVVIPQRKGEPKVFDTDEFPRFGTTAETLAKLKPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAEELGLKPMAKILSYGSKGLDPAIMGYGPFHATKKA
LEKANLTVEDLDLIEANEAFAAQSLAVAKDLKFDMSKVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDAKKGLATLCIGGGMGTALIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtagttattgtaagtgcagtaagaacagcattaggtagttttggtggagca
ttaaaagatgtctcagcagtagatttaggagctttagtaattaaagaagccgtaaataga
gctggagtaaaacctgaattaattgaagaagttattatgggtaatgtaattcaagctggt
cttggtcaaaataccgcaagacaatcaacaataaaagctggattaccacaagaagtttca
gctatgactattaataaggtttgtggatcaggtcttagagcagttagtttagcagcacaa
atgattaaagcaggagatgctgatgttgttgttgctggaggtatggaaaatatgtcagct
gccccatatgcattggacaaagcaagatggggacaaagaatgggcgatggtaaattagtt
gatacaatgataaaagacgcattatgggatgcttttaacaactaccatatgggagttaca
gctgaaaatattgctaaacaatggggattaactagagaagagcaagatgctttctcagct
gcatctcaacaaaaagctgaagcagcaattaaatctggaagatttaaagatgaaatagtt
ccagttgttattccacaaagaaagggagaaccaaaagtatttgatacagatgaattccca
agattcggaacaacagcagaaactttagctaaattaaagccagcatttattaaagatggt
actgttacagcaggtaatgcatcaggtattaatgatggagcagcagcttttgttgttatg
agtgcagaaaaagcagaagaattaggacttaagccaatggctaaaatactttcttatggt
tcaaaaggattagatccagctatcatgggatatggaccattccatgcaactaagaaagct
ttagaaaaagctaacttaacagtagaagatttagatttaatcgaagctaatgaagctttt
gctgctcaaagcttagcagttgctaaagatttaaaattcgatatgtcaaaagttaatgta
aatggtggagcaattgctttaggtcatccagttggagcatcaggtgcaagaatattagta
actcttcttcatgaaatggaaaagagagatgctaaaaaaggattagctacactttgtata
ggtggcggaatgggaacagcacttatcgttgaaagaatttaa

DBGET integrated database retrieval system