KEGG   Clostridium beijerinckii: Cbei_0421Help
Entry
Cbei_0421         CDS       T00547                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cbe  Clostridium beijerinckii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cbei_0421
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cbei_0421
Enzymes [BR:cbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cbei_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508686..509948
Genome map
AA seq 420 aa AA seqDB search
MEKIVVKGVKELRGEVNISCAKNSILPIIAATILCPEPIIIDNAPRLEDVEVICKLLSEL
NCDVNISNVNDRLTINTKNIVEMDANEELMRKMRASFLIMGPMLARFGYCKLSLPGGCNI
GSRPIDLHLKGFKLLGAEVVIGHGFVEVRAKKIVGNRIYLDFPSVGATENIMMVSVFAEG
TTIIENAAEEPEIWDLAQFLNKMGAKIEGAGFGKITITGVKNLKGISYTPIYDRIEAGTF
MIAAAITNSKIKINGVNEEHLRPVIEKLRECGIGFSNYKDHSIVVDGRGSKRPLDIKTLP
YPGFPTDMQAQMMSLLSIVEGVSVITETVFENRFMHVAELQRMGANIKIDGRTAIIEGKP
RLTGCEVKATDLRAGAAMILSGLVADGETVVNDVYHIDRGYVRIEEKFRNLGAEIYRINM
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatagtggttaaaggtgtaaaagaactgagaggggaagttaatataagttgt
gcaaaaaattcaattttaccaataattgcggcaactatattgtgcccagagcctataatt
attgataatgcacctaggttagaagatgttgaggttatttgtaagttattaagcgaacta
aactgtgacgttaatatttcaaacgtaaacgatagattaacaataaatacgaaaaatata
gtagaaatggatgctaatgaagagcttatgaggaaaatgagagcatcatttttaattatg
ggacctatgcttgctagatttggatattgtaaattatcattaccaggcggatgtaacata
ggaagtagaccaattgatttgcatcttaaaggatttaaattacttggagcagaggttgta
ataggtcatgggtttgtagaggtgagagcaaagaaaatagtgggcaacagaatttacctt
gattttccatctgttggcgctactgaaaatattatgatggtatctgtctttgctgaagga
acaactataatagagaatgcagcagaagaaccagagatctgggatttagcgcaattctta
aataagatgggggctaaaatagaaggagcaggatttggaaagataactataactggtgtt
aaaaatctaaaaggaattagttatacacctatatatgatagaatagaagcagggacattt
atgatagcagcagctattacaaatagtaaaataaagataaatggagtgaatgaagagcat
ttaagacctgtaatagaaaagttaagagaatgtggaataggttttagcaattacaaagat
cattccattgtagtagatggacggggaagtaagaggccattggatatcaaaacacttcct
tatccaggatttccaaccgatatgcaagctcaaatgatgagtttattatctattgttgaa
ggtgttagtgttattacagaaacagttttcgaaaatagatttatgcatgttgctgaattg
caaaggatgggagccaacatcaagattgatggaagaactgctataattgaaggcaagcca
agactcacaggctgcgaagttaaagcaactgatttaagggctggggcagcaatgatacta
agtggattagtagcagatggtgaaacagtggtaaatgatgtttatcatattgatagagga
tatgtaagaattgaagaaaagtttaggaatttaggagcagaaatatatagaataaatatg
tag

DBGET integrated database retrieval system