KEGG   Clostridium beijerinckii: Cbei_0429Help
Entry
Cbei_0429         CDS       T00547                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cbe  Clostridium beijerinckii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cbei_0429
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cbei_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
518230..520458
Genome map
AA seq 742 aa AA seqDB search
MEVLNGFVENIVFKSEDTGYVVCRIRNEKTLISAVGTVPFLREGQNVKLTGYWTVHKQFG
NQFNIQDYEELLPNSLDGIEKYLSAGIIHGIGPVTAKKIIERFGEETLDIMENHIERLME
IEGIGEKKFQIIYESYIEQQGLKDIILYFHKHGVTNNQCVKIYKKFGANARQIVSDNPYI
LCDEISGIGFKTADRIAMSIGIEKNSEFRIQSGIKYVMNQFCSAGNTFMPKNNIIEECEN
NLLISKELIEKNIYDMAAQQKIIVENINGTEVGFLLQYYYCELGVTSKIITLGLQQIQTI
NSDIDFEINVFEKEQNIKFAESQREAIIGAFNNGIEIITGGPGTGKTTIIKAIIHIYENN
GMKVILGAPTGRAAKRMTESTGREAKTIHRLLEMGISEDDESVFEKGESSPLDCDVIIID
EASMIDIILMQNLLKAINLGTRLIIVGDVDQLPSVGPGNVLKDLIESDYIKVVRLKEIFR
QGSESLIVVNAHRINEGQMPLLNQKDRDFFFISEDNQERIANTIMDLINRRLPKFNKSWN
KLKDMQVLTPMRKGVLGVTNLNTKLQEMFNASSKDKKEKTSRDIIFREGDKVMQTKNNYT
LKWIRVSGYGENEGVGVFNGDLGFIESIDEERKTLTIIFDEERKVIYDFNFLDELDLAYA
TTIHKSQGSEFKVVIIPVFMGSPFLMNRNLLYTGITRAKQLVVVVGFQKALMYMINNTNS
IERYSSLRYRIREIITKDEFEE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaagttctaaatggatttgttgagaatattgtttttaaaagtgaagatactggttat
gtcgtttgtagaattagaaacgaaaagacattaattagtgctgtaggaacagttcctttc
ttgagagaaggacaaaatgtaaagttaacaggatactggacagtacacaaacaatttggt
aatcaatttaatattcaggattatgaagaacttcttccaaattcattagatggcatagaa
aaatatttaagtgcaggaataatacatggaattggaccagttacggctaagaaaataata
gagagatttggtgaagaaactctagacataatggaaaaccatattgagaggcttatggag
atagagggtataggggaaaagaaatttcaaataatatatgaatcctatatagagcaacaa
ggtttaaaagatataatcttatattttcataaacacggagtcactaataatcagtgtgta
aaaatatataagaaatttggtgcaaatgcgaggcagatagtatctgataatccatatata
ttatgcgatgaaatatcgggaattgggtttaaaacagctgacagaattgctatgagcatt
ggcattgaaaagaattcagagtttagaattcaaagtggcattaaatatgttatgaatcaa
ttttgctctgcaggaaacacatttatgcctaaaaataatataatagaagaatgcgaaaat
aatttgttaatatctaaggaattaattgaaaaaaatatatatgacatggctgcgcaacaa
aaaattattgttgaaaacataaacggtactgaagtcggatttttgcttcaatattattat
tgcgagctaggtgttactagtaaaataataactttaggtttgcagcaaattcagactata
aactcggatattgatttcgaaattaacgtttttgaaaaggaacaaaatataaaatttgca
gaatcacaaagagaagcaattattggcgcatttaataatggtatagaaataattaccggt
gggccaggaacagggaagactacaattataaaggcaataatacatatatatgagaataat
ggaatgaaagtaatacttggggcaccaacaggaagagctgcaaagaggatgactgaatca
acagggagagaagctaaaacaatacatagactattagaaatgggaatttctgaggatgat
gaatcagtatttgaaaaaggagaatcatcgcctctagattgtgatgtaataataattgat
gaggcgtctatgattgacattatcttaatgcagaatctactaaaagcaattaatttagga
actaggttgataattgtgggagatgttgatcaattaccttctgttggaccaggaaatgtg
ctaaaagatcttatagaaagcgattatataaaggtggtaagattaaaagagatatttagg
caaggatcagaaagtttaattgtagtaaatgctcatagaataaatgagggacagatgcct
ttgctaaatcaaaaagatagagattttttctttattagcgaagataatcaagaaagaatt
gcaaatactataatggatctaataaatagaagactccctaagtttaataagtcttggaat
aaactgaaggatatgcaggttttaactcctatgagaaaaggtgtgcttggagtcacaaat
ttaaatacgaagcttcaagaaatgtttaatgcatcatcaaaagataaaaaggaaaagact
tctcgagatataattttcagagaaggtgataaggtaatgcaaacaaaaaacaattataca
ttaaagtggattagggttagtggttatggcgaaaatgaaggagtgggagtttttaatggt
gatctgggattcatagaaagcatcgatgaagaaagaaaaacactcacaatcatatttgat
gaagaaagaaaagttatatatgattttaattttttagatgagttggatttggcttatgct
actacaatacataaaagccaaggaagtgaatttaaggttgtaataattccggtatttatg
ggatcgccatttcttatgaatcgtaatttgctttatacaggtattacgagggcaaaacaa
ttagtagtagttgttgggtttcaaaaagcattaatgtatatgattaataatacaaatagt
atagaaagatactcatctttgagatatagaataagagagataataaccaaagatgaattc
gaagaataa

DBGET integrated database retrieval system