KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0429Help
Entry
Cbei_0429         CDS       T00547                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cbei_0429
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cbei_0429
DNA repair and recombination proteins [BR:cbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cbei_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD PIF1 PhoH HHH_2 AAA DNA_pol_lambd_f AAA_28 UvrD_C AAA_12 DUF2075 AAA_22 T2SSE AAA_23 NTPase_1 AAA_18 AAA_29 cobW ABC_tran SRP54 HHH_3 AAA_24 ArgK AAA_16 SMC_N TrwB_AAD_bind MobB DUF815
Motif
Other DBs
NCBI-ProteinID: ABR32617
JGI: Cbei0429
UniProt: A6LQI7
Position
518230..520458
Genome map
AA seq 742 aa AA seqDB search
MEVLNGFVENIVFKSEDTGYVVCRIRNEKTLISAVGTVPFLREGQNVKLTGYWTVHKQFG
NQFNIQDYEELLPNSLDGIEKYLSAGIIHGIGPVTAKKIIERFGEETLDIMENHIERLME
IEGIGEKKFQIIYESYIEQQGLKDIILYFHKHGVTNNQCVKIYKKFGANARQIVSDNPYI
LCDEISGIGFKTADRIAMSIGIEKNSEFRIQSGIKYVMNQFCSAGNTFMPKNNIIEECEN
NLLISKELIEKNIYDMAAQQKIIVENINGTEVGFLLQYYYCELGVTSKIITLGLQQIQTI
NSDIDFEINVFEKEQNIKFAESQREAIIGAFNNGIEIITGGPGTGKTTIIKAIIHIYENN
GMKVILGAPTGRAAKRMTESTGREAKTIHRLLEMGISEDDESVFEKGESSPLDCDVIIID
EASMIDIILMQNLLKAINLGTRLIIVGDVDQLPSVGPGNVLKDLIESDYIKVVRLKEIFR
QGSESLIVVNAHRINEGQMPLLNQKDRDFFFISEDNQERIANTIMDLINRRLPKFNKSWN
KLKDMQVLTPMRKGVLGVTNLNTKLQEMFNASSKDKKEKTSRDIIFREGDKVMQTKNNYT
LKWIRVSGYGENEGVGVFNGDLGFIESIDEERKTLTIIFDEERKVIYDFNFLDELDLAYA
TTIHKSQGSEFKVVIIPVFMGSPFLMNRNLLYTGITRAKQLVVVVGFQKALMYMINNTNS
IERYSSLRYRIREIITKDEFEE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaagttctaaatggatttgttgagaatattgtttttaaaagtgaagatactggttat
gtcgtttgtagaattagaaacgaaaagacattaattagtgctgtaggaacagttcctttc
ttgagagaaggacaaaatgtaaagttaacaggatactggacagtacacaaacaatttggt
aatcaatttaatattcaggattatgaagaacttcttccaaattcattagatggcatagaa
aaatatttaagtgcaggaataatacatggaattggaccagttacggctaagaaaataata
gagagatttggtgaagaaactctagacataatggaaaaccatattgagaggcttatggag
atagagggtataggggaaaagaaatttcaaataatatatgaatcctatatagagcaacaa
ggtttaaaagatataatcttatattttcataaacacggagtcactaataatcagtgtgta
aaaatatataagaaatttggtgcaaatgcgaggcagatagtatctgataatccatatata
ttatgcgatgaaatatcgggaattgggtttaaaacagctgacagaattgctatgagcatt
ggcattgaaaagaattcagagtttagaattcaaagtggcattaaatatgttatgaatcaa
ttttgctctgcaggaaacacatttatgcctaaaaataatataatagaagaatgcgaaaat
aatttgttaatatctaaggaattaattgaaaaaaatatatatgacatggctgcgcaacaa
aaaattattgttgaaaacataaacggtactgaagtcggatttttgcttcaatattattat
tgcgagctaggtgttactagtaaaataataactttaggtttgcagcaaattcagactata
aactcggatattgatttcgaaattaacgtttttgaaaaggaacaaaatataaaatttgca
gaatcacaaagagaagcaattattggcgcatttaataatggtatagaaataattaccggt
gggccaggaacagggaagactacaattataaaggcaataatacatatatatgagaataat
ggaatgaaagtaatacttggggcaccaacaggaagagctgcaaagaggatgactgaatca
acagggagagaagctaaaacaatacatagactattagaaatgggaatttctgaggatgat
gaatcagtatttgaaaaaggagaatcatcgcctctagattgtgatgtaataataattgat
gaggcgtctatgattgacattatcttaatgcagaatctactaaaagcaattaatttagga
actaggttgataattgtgggagatgttgatcaattaccttctgttggaccaggaaatgtg
ctaaaagatcttatagaaagcgattatataaaggtggtaagattaaaagagatatttagg
caaggatcagaaagtttaattgtagtaaatgctcatagaataaatgagggacagatgcct
ttgctaaatcaaaaagatagagattttttctttattagcgaagataatcaagaaagaatt
gcaaatactataatggatctaataaatagaagactccctaagtttaataagtcttggaat
aaactgaaggatatgcaggttttaactcctatgagaaaaggtgtgcttggagtcacaaat
ttaaatacgaagcttcaagaaatgtttaatgcatcatcaaaagataaaaaggaaaagact
tctcgagatataattttcagagaaggtgataaggtaatgcaaacaaaaaacaattataca
ttaaagtggattagggttagtggttatggcgaaaatgaaggagtgggagtttttaatggt
gatctgggattcatagaaagcatcgatgaagaaagaaaaacactcacaatcatatttgat
gaagaaagaaaagttatatatgattttaattttttagatgagttggatttggcttatgct
actacaatacataaaagccaaggaagtgaatttaaggttgtaataattccggtatttatg
ggatcgccatttcttatgaatcgtaatttgctttatacaggtattacgagggcaaaacaa
ttagtagtagttgttgggtttcaaaaagcattaatgtatatgattaataatacaaatagt
atagaaagatactcatctttgagatatagaataagagagataataaccaaagatgaattc
gaagaataa

DBGET integrated database retrieval system