KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0584Help
Entry
Cbei_0584         CDS       T00547                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00030  Pentose phosphate pathway
cbe00051  Fructose and mannose metabolism
cbe00052  Galactose metabolism
cbe00680  Methane metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0584
   00030 Pentose phosphate pathway
    Cbei_0584
   00051 Fructose and mannose metabolism
    Cbei_0584
   00052 Galactose metabolism
    Cbei_0584
  Energy metabolism
   00680 Methane metabolism
    Cbei_0584
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cbei_0584
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cbei_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABR32771
JGI: Cbei0584
UniProt: A6LQZ1
Position
694536..695753
Genome map
AA seq 405 aa AA seqDB search
MSNCIIAQSGGPTAVINSSVVGLLNANKELKTFEKVYGGLNGIEGILNRNIIDLSSVSEN
EIDNFRFTPSSGLGSCRYKLKDLDSCSEEYESLIEILREYDITSFFYVGGNDSMDTIAKL
SRYAKQNDIGISFIGIPKTIDNDLKFTDHTPGFGSAAKFIGTTALETYLDASVYINNGIF
ILETMGRDTGWLAASACIAKLDGKPIADFIYLPEAAFDKIKFLNDVRQRFEEQNKVYIIV
SEGIRDKDGRFISEFDCVSQDKFGHVQLGGVSEYLRRIILDAGFTTRVKALQLGVLQRCA
MHCASDTDLTEAYNAGKMALQYASQGESGKMVSINRLSNEPYEVNYPLVNAEDVANNVKY
FPIEWINKEGNFVTPEACSYFEPLIKDSPNLAFERNLPKYKVFNQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattgtataatagctcaatctggggggccaacagcagtaattaattcaagtgta
gtaggacttttaaatgctaataaagaactaaaaacttttgaaaaagtttatggaggccta
aatggtattgagggtatattaaatagaaatataattgatttgtcatcagtttcagaaaat
gaaatagataattttagatttactccatcttcaggacttggatcttgtaggtataaatta
aaagatttagattcttgtagtgaagaatatgaaagtttaatagaaatacttagagaatat
gatataacgtcattcttttatgttggtgggaatgattctatggataccatagcaaagctt
tcacgatatgcaaaacaaaatgatattggaataagttttataggtatacctaaaactatt
gataatgatttaaaattcactgatcatactcctggctttggcagcgcagcaaaattcatt
ggaacaacagcgcttgagacatatttagatgcatcagtttacataaacaacggtatattt
attttagaaacaatgggaagggatacaggatggcttgcagcttctgcatgtattgcaaag
cttgatggaaaaccaattgcagattttatatatcttcctgaagcagcttttgataaaatt
aaatttttaaatgatgttaggcaaagatttgaagaacaaaataaagtgtatataattgta
tcagaaggaataagagataaagatggaagattcatttctgaatttgattgtgtttctcaa
gataaatttggacacgttcaattaggaggtgtatctgaatacttaagaaggataattctt
gatgctggatttacaacaagagtaaaagcactgcaacttggggttcttcaacgttgtgca
atgcattgtgcttcagacactgatttaacagaagcgtataatgctggaaagatggcttta
caatatgcttcacaaggagaatcagggaaaatggttagcattaacaggttatctaatgag
ccttatgaagtgaattacccattagttaatgcagaagatgtagcaaataatgttaagtat
ttccctatagaatggattaataaagaaggtaattttgtaacacctgaagcgtgctcatat
tttgagccattaatcaaagattctcctaatttagcttttgagagaaatcttccaaaatat
aaggtatttaatcaatag

DBGET integrated database retrieval system