KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0599Help
Entry
Cbei_0599         CDS       T00547                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cbei_0599 (tpiA)
   01230 Biosynthesis of amino acids
    Cbei_0599 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0599 (tpiA)
   00051 Fructose and mannose metabolism
    Cbei_0599 (tpiA)
   00562 Inositol phosphate metabolism
    Cbei_0599 (tpiA)
Enzymes [BR:cbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cbei_0599 (tpiA)
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cbei_0599 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cbei_0599 (tpiA)
  Exosomal proteins of melanoma cells
   Cbei_0599 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
713513..714259
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTIDEAVKMVEELKPLVKDATCDVVVCPTFVCLDAVKKAVAGSNIKV
AAQNMHFEESGAFTGEVAPGMLEAMGIDYVVLGHSERREYFNETDEALNKKVKKAFEHNI
TPILCCGESLEQRENGTTNKVIEAQIKADIAGLTNEQVEKLVIAYEPIWAIGTGKTATDE
QANETIKAIRAMVAEMYGSESAEKTRIQYGGSVKPNTIKAQMEMSDIDGALVGGASLVPA
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattatcgcaggaaactggaaaatgaataaaactattgatgaagcagtt
aaaatggtagaagaattaaagccattagttaaagatgctacatgtgatgtagttgtatgt
cctacatttgtatgtttagatgctgttaaaaaggctgtagctggttcaaatataaaggtt
gctgcacaaaacatgcattttgaagaaagtggagctttcacaggagaagttgctccagga
atgcttgaagctatgggaatagattatgttgttttaggtcatagtgaaagaagagaatac
ttcaatgaaactgatgaagcattaaacaaaaaagttaagaaagctttcgaacataatatt
actccaatactttgttgtggagaatctttagaacaaagagaaaacggaactactaataaa
gttattgaagctcaaataaaagctgatatagctggattaactaatgaacaagtagaaaaa
cttgttattgcttacgaaccaatctgggcaattggaacaggaaaaactgctactgatgaa
caagcaaatgaaacaatcaaggctataagagctatggttgctgaaatgtatggatcagaa
tcggctgaaaaaacaagaattcaatacggtggatcagttaaaccaaatacaataaaagca
caaatggaaatgtctgatatagacggagcattagttggtggagctagcttagttccagct
gatttcgctgcaatagttaattattag

DBGET integrated database retrieval system