KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0599Help
Entry
Cbei_0599         CDS       T00547                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00051  Fructose and mannose metabolism
cbe00562  Inositol phosphate metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
cbe01230  Biosynthesis of amino acids
Module
cbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0599
   00051 Fructose and mannose metabolism
    Cbei_0599
   00562 Inositol phosphate metabolism
    Cbei_0599
Enzymes [BR:cbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cbei_0599
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cbei_0599
  Exosomal proteins of bladder cancer cells
   Cbei_0599
  Exosomal proteins of melanoma cells
   Cbei_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABR32786
JGI: Cbei0599
UniProt: A6LR06
Position
713513..714259
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTIDEAVKMVEELKPLVKDATCDVVVCPTFVCLDAVKKAVAGSNIKV
AAQNMHFEESGAFTGEVAPGMLEAMGIDYVVLGHSERREYFNETDEALNKKVKKAFEHNI
TPILCCGESLEQRENGTTNKVIEAQIKADIAGLTNEQVEKLVIAYEPIWAIGTGKTATDE
QANETIKAIRAMVAEMYGSESAEKTRIQYGGSVKPNTIKAQMEMSDIDGALVGGASLVPA
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattatcgcaggaaactggaaaatgaataaaactattgatgaagcagtt
aaaatggtagaagaattaaagccattagttaaagatgctacatgtgatgtagttgtatgt
cctacatttgtatgtttagatgctgttaaaaaggctgtagctggttcaaatataaaggtt
gctgcacaaaacatgcattttgaagaaagtggagctttcacaggagaagttgctccagga
atgcttgaagctatgggaatagattatgttgttttaggtcatagtgaaagaagagaatac
ttcaatgaaactgatgaagcattaaacaaaaaagttaagaaagctttcgaacataatatt
actccaatactttgttgtggagaatctttagaacaaagagaaaacggaactactaataaa
gttattgaagctcaaataaaagctgatatagctggattaactaatgaacaagtagaaaaa
cttgttattgcttacgaaccaatctgggcaattggaacaggaaaaactgctactgatgaa
caagcaaatgaaacaatcaaggctataagagctatggttgctgaaatgtatggatcagaa
tcggctgaaaaaacaagaattcaatacggtggatcagttaaaccaaatacaataaaagca
caaatggaaatgtctgatatagacggagcattagttggtggagctagcttagttccagct
gatttcgctgcaatagttaattattag

DBGET integrated database retrieval system