KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0659Help
Entry
Cbei_0659         CDS       T00547                                 

Definition
(GenBank) signal transduction histidine kinase regulating citrate/malate metabolism
  KO
K07706  two-component system, LytTR family, sensor histidine kinase AgrC [EC:2.7.13.3]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe02020  Two-component system
cbe02024  Quorum sensing
Module
cbe_M00495  AgrC-AgrA (exoprotein synthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cbei_0659
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cbei_0659
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Cbei_0659
Protein kinases [BR:cbe01001]
 Histidine kinases
  LytTR family [OT]
   Cbei_0659
Two-component system [BR:cbe02022]
 LytTR family
  AgrC-AgrA [MD:M00495]
   Cbei_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ABR32846
JGI: Cbei0659
UniProt: A6LR66
Position
789261..790523
Genome map
AA seq 420 aa AA seqDB search
MRLLADIIVSMIQAIIFAYSTECCLKSENKLNKLKVVLITIVTFIINSSFTSIFGNISIC
VFIIHISCLVVMIFSYKDNKLKSMIPYTLTYSFMGVYGIISYNLFFGFIEGMIPVEYADI
ANILIIYVPYILFLYLCIKYMGKFIEMYKLAVSEKINMIVIITISFCLDFVLAFYLIIYN
DESKMLKNMIITILCVFLAFIIKYFANIKKKSDQIFKLNEALEEKNSELRKIKHDYGAQI
SYLYGLCLMERFDDLKKSLKDIINKNDSTPTAVEVSENRNSILSLALKPAIDMGIHVIIE
ENCDFSLVSITEMEFYRIISNIVNNAIKAMNGKGIIIAKAYEYLGNVIVRIENNGPRIPE
QHLNDIFKVGFTTKENSDQSHGYGLSIVKDLVESHNGKIYVKSSDVVTEFKIVFPIKNFV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtttattggcagatataatagtctctatgattcaagctataattttcgcgtattca
acagaatgctgcttgaagagtgaaaataaattaaacaaacttaaagtagttttaataacc
atagttacttttattataaacagtagctttacaagtatatttggaaacatatctatctgt
gtgtttataatacatatatcatgtttagttgtaatgattttctcatataaagataacaaa
ctaaagtcaatgattccctatacattgacatattcttttatgggggtatatggaattata
tcatataatttattttttggttttatagaaggtatgataccagtagaatatgcagatata
gctaatattttgattatatatgttccttatattttattcttatacttatgtataaaatac
atgggcaagtttatagaaatgtacaagctagcagttagtgaaaagattaatatgatcgtg
attataacaataagcttctgtctagatttcgttttggccttttatttaataatctataat
gatgaatctaaaatgttaaaaaatatgataatcacaatcttgtgcgtatttttagcgttt
atcataaaatattttgcaaatataaagaagaaatcagatcaaatatttaaattaaatgaa
gctctagaagaaaaaaatagcgaacttagaaagattaagcatgactacggagcacagata
tcatatttatatggactttgtctaatggaaagattcgatgatttaaaaaaatctctaaaa
gatattataaataagaatgactctacgccaacagctgtagaagttagcgagaatagaaat
tctatattatcccttgcattaaaaccggctattgatatgggaatacatgtaataatagaa
gaaaattgtgatttctctttagtgagtattactgaaatggagttttatagaataatatct
aatatagtaaataatgcaataaaagcaatgaacggcaaaggtataataattgcaaaggct
tatgaatatttaggaaatgtaatagtaagaatagagaataatggccctagaattccagaa
caacatctgaatgatatatttaaagttgggtttactacaaaggaaaatagtgatcaaagt
catggatacgggttaagtattgtaaaggatttagtagagagtcataatggtaagatatat
gtgaaaagtagcgatgtagttactgaatttaaaatagtatttcctataaagaattttgta
taa

DBGET integrated database retrieval system