KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0660Help
Entry
Cbei_0660         CDS       T00547                                 

Definition
(GenBank) Accessory gene regulator B
  KO
K07813  accessory gene regulator B
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe02020  Two-component system
cbe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cbei_0660
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cbei_0660
Peptidases [BR:cbe01002]
 Cysteine Peptidases
  Family C75
   Cbei_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AgrB HRG
Motif
Other DBs
NCBI-ProteinID: ABR32847
JGI: Cbei0660
UniProt: A6LR67
Position
790809..791366
Genome map
AA seq 185 aa AA seqDB search
MVDSISKKIINSISTNEKYNEDKLEQMEYVLKVLLNELIKTILVITIFSAFGYFKEIIII
DLTMCVIKPFIGGYHENTQIKCFVATLILEIGILILSLQCNIGFISNCILISLSIFCIWN
QAPIINSKMPISRPQLLMNNRIRGLSTSIFLGALSVVLYNYSIYYSLITWTILFQAILMF
NKRES
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggtagatagtatttcgaaaaaaattataaatagtatatcaactaatgagaaatataac
gaagataaacttgagcagatggaatatgtattaaaagttcttctaaatgaattaataaaa
acaatattagtgataacaattttttcagcatttggatattttaaagaaataattattatt
gatttgactatgtgtgttattaagcctttcattggagggtatcatgaaaatacacagatt
aaatgttttgtagctacactcatattggaaattgggatcttgattttaagtttacaatgt
aatattggttttataagtaattgtatcttaatttctttaagtatattctgcatatggaat
caagctccaataatcaattctaaaatgccaatttcgcgtcctcaattactaatgaacaat
aggattagaggtttaagcacttcaatatttttaggagcattgtctgtggttttgtataat
tacagtatttattattctttaataacatggacaattttatttcaagctatactaatgttt
aataagagagaaagttaa

DBGET integrated database retrieval system