KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0662Help
Entry
Cbei_0662         CDS       T00547                                 

Definition
(GenBank) glutamate synthase (NADPH), homotetrameric
  KO
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Cbei_0662
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cbei_0662
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Cbei_0662
    1.4.1.14  glutamate synthase (NADH)
     Cbei_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
792760..794154
Genome map
AA seq 464 aa AA seqDB search
MDMNERLVRIPVREQDPKVRAANFEEVCLGYNEEEATKEASRCLNCKNPKCVEGCPVSIN
IPGFISYVKDEKFEEAAKEISKYSSLPAVCGRVCPQERQCEGRCVLGIKGDSVSIGKLER
FTADWAASHNVDLSATEPKNGIKVAVIGSGPAGLTCAGDLAKKGYEVTIFEALHKAGGVL
EYGIPEFRLPKEKVVKNEVENIKKLGVKIETNVIVGRTITIDQLFEDEGFKAVFIGSGAG
LPRFMGIPGENANGVCSANEFLTRVNLMKAAVEGYDTPVRSGKKVAVVGGGNVAMDAART
ALRLGSESHIVYRRGESELPARVEEVHHAKEEGVIFDVLTNPTEILVDENGWVKGMKCVR
MELGEPDASGRRSPVEVPGSEFVMDVDTVIMSLGTSPNPLISSTTQGLEINKRRCIVAEE
ETGLTTKEAVYAGGDAVTGAATVILAMGAGKKAAKAIDEYLQEK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaatgagagattagttagaataccagtaagagagcaagatccaaaggttaga
gcagcgaactttgaagaagtttgtcttggatataacgaagaagaagcaactaaagaagct
tctagatgtttaaactgtaagaatcctaagtgtgtagaaggatgtccagtatcaatcaat
ataccaggattcatttcttatgttaaagatgaaaaatttgaagaagcagcaaaagaaatt
tcaaaatacagctcacttccagcagtttgtggaagagtatgtccacaagaaaggcaatgt
gaaggaagatgtgttttaggaataaagggtgactcagtatctattggtaaacttgaaaga
tttacagcagactgggcagcatcacataatgttgatttaagtgcaacagaacctaaaaat
ggaattaaagttgcagttataggaagtggtcctgcaggacttacttgtgctggagattta
gctaaaaaaggatatgaagtaactatatttgaggcacttcataaagcaggcggagtttta
gaatatggaattccagaattcagacttccaaaagaaaaagtagttaaaaatgaagttgaa
aacattaagaaacttggtgttaaaatagaaactaatgttatagttggcagaactataact
atagatcaattatttgaagatgaaggatttaaagctgtatttataggttcaggtgcaggg
cttccaagattcatgggaataccaggagaaaatgcaaatggagtatgctcagcaaatgaa
tttttaacaagagtaaacttaatgaaagcagcagtagaaggatacgacactccagttaga
tctggtaaaaaagttgcagtagtaggcggaggaaatgttgctatggacgcagcaagaact
gccttaagacttggatctgaaagccatatcgtttatagaagaggtgaatcagaacttcca
gcaagagtagaagaagtacatcatgctaaggaagaaggagtaatctttgacgtattaact
aatccaacagaaatcttagtagatgaaaatggatgggttaaaggaatgaaatgtgtaaga
atggaacttggagaaccagatgcatcaggaagaagaagtccagttgaagttcctggttca
gaatttgttatggatgtagacactgtaataatgtcacttggaacatcaccaaatccatta
atttcatcaacaactcaagggttagaaattaataagagaagatgtatcgtagctgaagaa
gaaacaggtcttactactaaagaagcagtttatgctggtggagatgcagttacaggagca
gcaacagtaatacttgctatgggtgctggtaagaaggcagcaaaagcaatagatgagtat
ttacaagaaaaataa

DBGET integrated database retrieval system