KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0670Help
Entry
Cbei_0670         CDS       T00547                                 

Definition
(GenBank) hypothetical protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH_2
Motif
Other DBs
NCBI-ProteinID: ABR32857
JGI: Cbei0670
UniProt: A6LR77
Position
805611..806606
Genome map
AA seq 331 aa AA seqDB search
MGISTKLIGKQILEAILSESNCKFGSTKIKNIDYLINENIGIKVVVRNRETQKIKDDTIY
EKISSINGFDNACKENDLLPYYCIAQILENNINVLLFSLQKAREEITNSGLNINIKESSI
KNNECIFDGVLWRLLRKEEIFINDKFIKGNAELIYVGEDVALYKKLFYIDEIAETIEDNP
EVEKEDNLDDMDINSLKDLGTTEKEQLVKSRIGQGKLKELLIKKDCKCKICGLNDERFLI
ASHIQRWAESNDNERRDTNNAFLLCSDHDWLFDKFYISFDDAGNISLNDSLDKVIYENLK
ISKDLNNISLNSENKKYMKWHRKEFYKKNNI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggaataagcacaaaattaataggaaaacaaatacttgaagcaatattaagtgagagt
aattgtaaatttgggtcaaccaagataaaaaatattgattatttaataaatgaaaatata
ggtataaaagttgtagtaagaaatagagaaacgcagaaaataaaagatgatactatttat
gaaaaaatatcatctataaatggttttgacaatgcatgtaaagagaatgatttattgcca
tattattgcattgcccagatactggagaataatataaacgttcttctatttagtttacaa
aaagcaagagaagagattactaatagtggattaaatataaatataaaagaaagttcaatt
aaaaataatgaatgtatatttgatggggttttgtggagattgcttagaaaagaagaaata
tttattaacgataaattcattaaaggtaatgcagagttaatatatgttggagaagatgtt
gcactatataaaaaacttttttatatagatgaaattgctgaaactattgaagataaccca
gaagtagaaaaagaagataacttagatgatatggatataaatagtttaaaagatttaggt
actactgaaaaagaacaactagttaaatcaagaattggacagggtaagttaaaagaatta
ttaataaagaaagattgtaaatgtaaaatttgtggtttgaatgatgaaagatttttgata
gccagtcatatacagagatgggcagaatctaatgataatgagagaagagatactaacaat
gcatttcttctttgctcagaccacgattggctatttgataagttttatataagttttgat
gatgctggtaatatttcactaaatgatagtttagataaggtgatttatgaaaatttaaaa
ataagcaaggatttaaataatataagtcttaatagtgagaataaaaaatatatgaaatgg
cacagaaaagaattttataagaaaaacaacatataa

DBGET integrated database retrieval system