KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0675Help
Entry
Cbei_0675         CDS       T00547                                 

Definition
(GenBank) Coenzyme F390 synthetase-like protein
  KO
K01912  
phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Phenylalanine metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Cbei_0675
Enzymes [BR:cbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     Cbei_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(810761..811948)
Genome map
AA seq 395 aa AA seqDB search
MENNSVFWEFKEKCLNGYYKTPFQIPPSYWGLHEWDTLSEDEVMNMLFPFIKFQLKRAKN
SMEIYKNAYKDIDIDSINNMDDFNNKIPLLVKDSTIENIGFRGKVRENPYVLRPNDIKDP
MYIYKSGGTKGVATPTFITKNDLIRESHSFARSFYYEGIRPGDVALSTYNPTHKGGEAIK
EGLMLNGVTFIPRRTNETAEDIIKVIKDYNVNVLLTVQGDVLKGAQESKDAGVDFMSLVE
AGQDVLEKNIKTLFLGGYKLIDEATAWANTFEKPLVNAYGACEALVLATNTPSNGVNLCK
HNNFHLMYGPHIVEIVRYENGKLVQCKKGETGMVAITTIAREGTIYIRYLIGDKATVVAD
EGECSCGIKSKIISNLSRIDNPQDLISSGCMCTMG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataattctgttttttgggagtttaaagaaaagtgtttaaatggttattataaa
acaccatttcaaataccgccgtcatattgggggttgcatgaatgggacacgttaagtgaa
gatgaagtaatgaatatgttgtttccttttataaagttccaacttaaacgtgcaaaaaat
tcgatggaaatttacaagaacgcatataaggacatagatatagatagtataaataacatg
gatgactttaataataagattcctttattagtaaaagattccactattgagaatatagga
tttcgtggcaaagttagggaaaatccttacgtcttaagaccaaatgatataaaagatcca
atgtacatatataagtccggagggactaagggagttgcaactcctacatttattacaaaa
aatgatcttatacgagagtcacactcatttgctagatccttttactatgaagggattaga
cctggagatgtagctctttcgacttataaccctacacataagggtggcgaagcaattaaa
gaaggacttatgttgaacggagttacatttattccaagaagaaccaacgagactgcagaa
gatattataaaggtgataaaggactacaatgttaacgtactactaacagtacaaggggat
gtattgaaaggagcacaagaatcaaaagacgcaggagttgactttatgtccttagtagaa
gctggtcaggacgtgcttgagaaaaatattaaaactctttttttaggtggctataagttg
attgatgaggcaaccgcatgggctaatactttcgaaaaacctcttgtaaatgcgtatgga
gcttgtgaagcattggttcttgcgacaaatactccttcaaatggagtcaatttatgtaaa
cataataattttcatcttatgtatggacctcatattgttgaaatagtgcgttatgaaaat
ggaaagttagtacaatgcaaaaaaggtgaaactggtatggtagctattacaacaattgca
agggaagggactatctacatccgttaccttatcggagataaggcaactgttgtcgcagat
gagggtgaatgctcttgtggaattaaatcaaaaattatatcaaatttatcaagaatagac
aatcctcaggatcttatttcaagtggatgtatgtgtacaatgggttag

DBGET integrated database retrieval system