KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0682Help
Entry
Cbei_0682         CDS       T00547                                 

Definition
(GenBank) hypothetical protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
821573..821830
Genome map
AA seq 85 aa AA seqDB search
MNNNLKNEIEEMIKKLSMSHDDEESDNKVEETAEEYLKYIDSIRFIELITAIESKYDIEI
DNKDLVRENTKELDTFVSMVGKYMK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatttaaagaatgaaattgaagaaatgataaaaaaattatcgatgtcacat
gatgatgaagagagtgataataaagttgaggaaactgcagaagaatatcttaaatatatt
gattcaataagatttatagagttaataactgcaattgaaagtaaatatgatatagagata
gataataaagaccttgtaagagagaacacaaaagaattagatacatttgtttcaatggtt
gggaaatatatgaaatag

DBGET integrated database retrieval system