KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0683Help
Entry
Cbei_0683         CDS       T00547                                 

Definition
(GenBank) Radical SAM domain protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14 FtsH_ext HTH_45 EspA ImmE5 HemN_C
Motif
Other DBs
NCBI-ProteinID: ABR32869
JGI: Cbei0683
UniProt: A6LR89
Position
821927..823237
Genome map
AA seq 436 aa AA seqDB search
MIKEKILLPHQYYYPHMDLLADKSTLKKENAFFSELDNKSTIREASIYVHIPFCDSKCAF
CGFDKVKNTNEIPKYKDRIIEEIENYASKEYIKNLRVNVIHIGGGTPTILPKDVFNEILN
TIKEKFNVTDDLIVNIEGSATTIYKDEVIEYIKENNISKVSVGVQTFNQKLRDQYKSKAT
LDEVYLTLSKLKSNNITTGIDIMYGFPDFKIGDVKEITFNDIREAIRLGVDAIDFGQMYP
FCNNLEKRVEDEKLGFPNLEELVDIITTVNKMMEEAGYEQKASYGYTKKDKDILVMETAY
YGGIHNVPDCIALGSGAFGFINGYKYRNNSYNSYINGGSTRFSQLKKLTENQLENLNIVG
FPKLLFLSKQQLAQNGGAKYEGKIKELLNQGLLEEDEYAFKITEKGKCFIDNIYYFLLED
EEKRVIENQVRVLTIR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggaaaagattttacttccgcaccaatattattatccacatatggacttgtta
gctgataaaagcacattaaaaaaggaaaacgccttttttagtgaactggataacaaatca
actattagagaagcttcgatttatgttcatattccattttgtgattcaaaatgtgctttt
tgtggatttgataaagttaaaaatacaaatgagattcctaaatataaagatagaataatt
gaggaaattgaaaattatgcttctaaagagtatataaaaaacttgagagttaacgttatt
catattggtggtggtacaccgactattttacctaaagatgtatttaatgaaattttaaat
actattaaggaaaaattcaatgttacagatgatttaatagtaaatattgaaggttctgcc
actacgatatataaagatgaagtaattgaatatataaaggaaaataatatttcaaaagta
agcgtaggtgtacaaacttttaatcagaaattaagagaccaatataaatcaaaggccaca
ttagatgaagtttatttgacattatcaaagctaaaaagtaataacataactacaggtatt
gatattatgtatggattcccagattttaaaattggggatgtaaaggaaataactttcaac
gatattagagaagctataagattaggagtagacgcaattgattttggacaaatgtaccct
ttctgtaataatttagagaaaagggttgaagatgaaaaattaggattccctaatctagaa
gaacttgtggatataattacaactgtaaataagatgatggaggaagcaggttacgaacaa
aaagcatcttatggctacactaaaaaagataaagatatattagtaatggaaactgcatat
tatggtggaattcataatgttcctgattgtattgctcttggctcaggcgcttttggattt
ataaatggatataaatatagaaataattcatataattcttatataaatggaggcagcact
agattttcacaactaaaaaaattaacagagaaccaattggagaatttaaatattgtagga
tttcctaaattgttatttttatcaaagcagcaattagcacaaaatggtggtgctaaatat
gaaggtaaaattaaagagctattaaatcaaggattgctagaagaagatgagtatgctttt
aagataactgagaaaggaaagtgttttattgataatatatactatttccttttagaagat
gaggagaaacgcgtaatagaaaaccaagttagagtattgactatccgatag

DBGET integrated database retrieval system