KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0691Help
Entry
Cbei_0691         CDS       T00547                                 

Definition
(GenBank) acyl-ACP thioesterase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-ACP_TE 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ABR32877
JGI: Cbei0691
UniProt: A6LR97
Position
831345..832103
Genome map
AA seq 252 aa AA seqDB search
MLSIDKEYEINYYDIDLNWQLMFTSVMNLFQDTFVHMSENLGRGIRYLNSINLTWMVNKW
EINMYEYPTYNEKIKVRMTPIAYRKSLMNIQFEIFNSRGKKVADAFSLWILLDMKQKIPC
RNKFEDMFEVYGLKASENKINTMKKINISKNLINTKKLNVGYCDIDTNGHVNNVKYLYWI
LDTISEDIVKDYKITKLRISYKKSANYSDIITLSFTKNIENKLIVYSHKIADKENSVLVL
AETVLQKSYVDK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaattgataaagaatatgaaataaattattatgatattgatttaaattggcaa
ttaatgtttacgagtgtaatgaatttgtttcaagatacatttgtgcatatgtccgaaaat
ttaggaagaggaatacgatatcttaatagtataaatttaacgtggatggtaaataaatgg
gaaataaatatgtacgagtatccgacctataatgaaaaaataaaagtaagaatgactcct
attgcatatagaaaatctcttatgaatatacaatttgaaatatttaattcgagaggaaag
aaagtagcagatgctttttcattatggattttgttggatatgaagcaaaaaataccgtgt
agaaataaatttgaggatatgtttgaggtatatggattaaaagcaagtgaaaataaaatt
aatactatgaaaaaaattaatatatcaaaaaatttaattaatactaaaaaattgaatgtt
ggatattgtgacatagatactaatggacatgttaataatgtaaagtatttatattggata
ctcgatactatatcagaggacatagtaaaagactataagataacaaaattaagaattagt
tataaaaagtctgcgaactatagtgatataataacgttaagttttacaaagaatattgag
aataagttaattgtatattcacacaaaattgctgataaagagaattcagtgctagtatta
gcagaaactgttttgcaaaaaagttatgtagataaatga

DBGET integrated database retrieval system