KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0692Help
Entry
Cbei_0692         CDS       T00547                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  
3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cbei_0692
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cbei_0692
Enzymes [BR:cbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cbei_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
832744..833772
Genome map
AA seq 342 aa AA seqDB search
MSFLCVRKIPSPEEIKKLIPLENNLKEIKSERDAEVKEILAGKSNKFIVIIGPCSADDEN
SVCEYVNRLAKVNEEVKDKLFIIPRIYTNKPRTTGNGYKGMFHQPNPEKSPNIFDGLISI
RKMFIRSIKESHLTSADEMLYPSNHMYYDDLLTYTTVGARSVENQQHRLTASGVDIPVGM
KNPTSGDISVMFNSIQAAHSKHNFLYRYNEVNTTGNPYAHVIMRGSVNQHGKNIPNYHYE
DLMRVAEAYNKYDFPYPAVIVDANHANSMKIFSEQPRIVQEVLNTRKYNCDIKNLVKGVM
VESYIEEGCQKIDDHIYGKSITDSCLGWEATEKLLYYIAEQV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttttctatgtgtaagaaaaataccatctccagaggaaattaaaaaattaattccc
ctggaaaataatctaaaagagattaagagtgaaagagatgcagaagttaaagaaatactt
gctggaaaaagcaataaattcattgttatcataggaccgtgttcggcagacgatgagaat
tctgtttgtgagtatgttaacagattggcaaaagtaaatgaagaagttaaggataaactt
tttattattcctagaatatatacaaataagcctaggactacaggtaatggatataaaggg
atgtttcatcaaccgaatccagaaaaatcacctaatatttttgatggactaatttctatt
agaaaaatgtttattcgttcaataaaagagtcgcatcttacatctgctgatgaaatgctg
tatccttcgaatcatatgtattatgatgatttattaacttatacaacagttggagcgaga
agtgttgaaaatcaacagcatagattaactgctagtggtgttgatattcctgttgggatg
aaaaatccaacaagtggtgatatatcagtaatgttcaattcaatccaagcagcacattca
aaacataatttcttatacagatataatgaggtgaatacaactggtaatccatatgctcat
gtaattatgcgtggttcagttaatcagcatggtaaaaatatacctaattatcactatgag
gatttaatgagagttgctgaggcttataataaatatgattttccatatcctgcagtaatt
gttgatgcaaatcatgctaattcaatgaaaattttttcagaacaacctcgaatagtacaa
gaagtacttaatacaagaaagtataattgtgatataaaaaatttagttaaaggtgttatg
gttgaaagctatatagaagaaggatgtcaaaaaattgatgatcatatatacggtaaatca
attactgattcttgtttaggttgggaagcgaccgagaagttgctttattatattgctgaa
caagtataa

DBGET integrated database retrieval system