KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0698Help
Entry
Cbei_0698         CDS       T00547                                 

Definition
(GenBank) transcriptional regulator, RpiR family
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS SIS_2
Motif
Other DBs
NCBI-ProteinID: ABR32882
JGI: Cbei0698
UniProt: A6LRA2
Position
839233..839976
Genome map
AA seq 247 aa AA seqDB search
MFSYSQIKSLNDLEISVYNYIMDNKDKVRYMKIRELAVESHVSTTTILNFCKKVGCSGYS
EFKLKFKLFIEEKEIKKVSEDNTEIIDFFKKTNTEEYDEKIEEIVKAILKAKRTIFIGSS
MSGIIARYGARYLSSVGQFSLCIDDPYYPTTGKFYENSVVIVCSVSGESKDIIGHINRFK
KDNCCIVSITNTENCTIAKMSDYNIPYYVPYVKVGIYDITTQIPIISIIERIGRKLQNRR
EESIQDE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttcagttatagtcaaatcaaaagtcttaatgatttagaaatttctgtttataattat
attatggataataaagataaggtccgatatatgaaaataagggaattagcagttgaatcg
catgtatcaactacaaccatattaaatttctgcaaaaaagtaggttgtagtggttattca
gagtttaaactaaaatttaaattatttatagaagaaaaagaaattaaaaaagtaagtgaa
gataatacagagataattgacttttttaagaaaacaaatactgaagaatatgatgagaag
atagaggaaattgtaaaagctatattaaaagcaaagagaacaatttttataggaagtagt
atgtcaggaattatagcaagatatggagcaagatatctatcaagtgttggacaatttagt
ttatgcattgatgatccgtattacccgactacaggtaaattttatgaaaactcagttgtc
atagtatgttctgtgtctggagaatcgaaagatattataggccatataaatagatttaaa
aaagataattgctgtattgttagtattactaatactgaaaattgcactatagcgaaaatg
tctgattataatatcccctattatgtgccatatgttaaagtaggaatatatgatattaca
actcaaattccaataatcagtataatagaaagaattggaaggaaactacaaaatcgtcga
gaagaatctatacaagatgagtaa

DBGET integrated database retrieval system