KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0699Help
Entry
Cbei_0699         CDS       T00547                                 

Definition
(GenBank) phosphotransferase system, EIIC
  KO
K02752  
PTS system, beta-glucoside (arbutin/salicin/cellobiose)-specific IIB component [EC:2.7.1.-]
K02753  
PTS system, beta-glucoside (arbutin/salicin/cellobiose)-specific IIC component
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycolysis / Gluconeogenesis
Phosphotransferase system (PTS)
Module
PTS system, beta-glucoside (arbutin/salicin/cellobiose)-specific II component
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0699
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Cbei_0699
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     Cbei_0699
Transporters [BR:cbe02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component [MD:M00272]
    Cbei_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
840290..841717
Genome map
AA seq 475 aa AA seqDB search
MAKDYALIAKTIAKNLGGISNIESVTHCMTRLRVCLKDDSKVNVDEIKKINGVMGYVNQG
GQHQVIIGNNVSYVYKEVLKLGNFGDQSDIAKGIKKEKLTIKKVGTNILDALVSTMSPLI
PAIIGGSMVKLVVMMLSMLKVLPADSTTYTLLNAMGDAAFYFLPIMVAVSASKKFKTNTY
LAIAIAGLMVHPDFMKLMVSASEGKEVTLAFIPIASVKYTYTVIPALCMTWILSYIERFV
DKITPEVTKNFLKPAIIVLIAAPIAIGLIGPLGIWIGTAISGLVYFVHSKLGWVSVAIMG
ALWPLLVMTGMHRVFTPTILTTIAETGMEGMVMPSEIGANLSLGGSALAVAFKTKNKELR
QTAIAAASSAIIAGITEPALYGVALRFKRPLIASLISGGVCGAVAGIAGLASRSMAAPGL
FTSVQFFDPQNPSSLIWIIGIMILAVVLSFVLTLIFGFEDIPAEDNIEIMGADNE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggattatgcattaattgcgaaaacgattgcaaaaaatttaggcggtatctca
aatattgaaagtgtaactcattgtatgactcgtttaagagtttgtttaaaggacgactca
aaagtaaatgtagatgagattaaaaaaattaatggagtaatgggatatgtaaaccaaggt
gggcaacatcaagttattattggaaataatgtatcttatgtttataaggaagttttaaaa
ttaggaaactttggagatcaaagtgacattgcaaaagggataaaaaaagaaaagctaact
atcaaaaaagttggaactaatatattggatgcattagtaagtacaatgtcaccattgata
ccagcaattattggtggttcaatggtaaagttagtagtaatgatgttatctatgttaaaa
gtactaccagcagacagtactacatatacattactaaatgctatgggagatgcagcgttt
tatttccttccaattatggtggcagtatcagcatctaagaaatttaaaactaatacttat
ttagctattgcaatagcaggacttatggtacatccagattttatgaaactaatggtaagc
gcatcagaaggtaaggaagtaactttagcgtttattcctattgcatctgttaagtatacg
tatacggtaataccagcactttgtatgacttggatattatcatatattgaaagatttgta
gataagataacaccagaagtaactaaaaatttcttaaaaccagcgattatagtattgatt
gcggctccaatagcaattggacttataggacctttaggtatatggattggtacagcaata
tcaggtttagtttattttgttcacagcaaattaggatgggtatcagtagcaataatggga
gctttatggccactacttgttatgactggaatgcatagagtatttactccaactatatta
acaactatagcagaaacaggaatggaaggaatggtaatgccttcagaaataggtgcgaac
ctttcattaggaggatcagctttagctgttgctttcaaaactaaaaataaagagttaaga
caaactgcaattgcagctgcttcttctgcaatcattgcgggaatcacagaaccagcactg
tatggagtagcattaagatttaaaaggcctttgatagcatcattaatttcaggtggtgta
tgtggtgccgtagcagggatagcaggactcgcaagtagatctatggctgcaccaggtttg
ttcacaagtgttcagttttttgatccacaaaatccatcaagccttatttggataattgga
ataatgatactggcagtcgtattatctttcgtattaactctaatatttggatttgaagat
attccagcagaagataatattgaaataatgggggcagacaatgagtaa

DBGET integrated database retrieval system