KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0713Help
Entry
Cbei_0713         CDS       T00547                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IID subunit
  KO
K02796  
PTS system, mannose-specific IID component
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cbei_0713
   00520 Amino sugar and nucleotide sugar metabolism
    Cbei_0713
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Cbei_0713
Transporters [BR:cbe02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    Cbei_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
858548..859459
Genome map
AA seq 303 aa AA seqDB search
MSKELKLTKRDRISVWFRSFFLQGSWNYERMQNGGWAFAMIPAIRKLYKTKEERAAALER
HLEFFNTHPYVASPVVGVTLALEEERANGAPIDDVTIQGVKIGMMGPLAGIGDPVFWFTV
RPILGALAASLALGGNILGPIIFFFAWNIIRMAFMWYTQEFGYKAGSRISEDLSGNMLQD
ITKGASILGMFILGSLVNRWVSVKFAPVVSSVKLSDGAFIDWSKLPAGAEGVKQALLQQA
SGMSLTDTKITTLQNNLDSLIPGFVGLLITLLCMWLLKRKVSPILIILGLFIIGIVFHLI
GLM
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaattaaaattaacaaaaagagaccgtatttctgtttggttccgttcattt
ttccttcaaggttcttggaactatgaaagaatgcaaaatggtggttgggcatttgcaatg
attccagcaatcagaaaattatataagactaaagaagagagagctgcagcattagaacgt
cacttagagttctttaacactcacccatatgtagcttcaccagttgttggtgtaacatta
gctttagaagaagaacgtgcaaatggtgcaccaatcgacgatgtaactattcaaggtgtt
aagattggtatgatgggacctttagcaggtattggagatccagttttctggttcactgta
agaccaattttaggagcattagctgcttcacttgctctaggtggtaacatccttggacca
attatcttcttcttcgcttggaatatcatccgtatggcatttatgtggtatacacaagag
tttggttacaaagcaggatctcgtattagtgaagatttatcaggtaatatgctacaagat
attacaaaaggagcatctatccttggtatgttcatcttaggatcgttagttaacagatgg
gtatctgttaaatttgcaccagtagtatcatctgttaaattaagtgatggtgcatttatt
gattggagcaaacttcctgctggagcagaaggtgttaagcaagctctattacaacaagca
tcaggtatgtcattaactgatactaagattacaacattacaaaataacttagattcatta
atccctggatttgtaggattattaattacacttctttgtatgtggttacttaagaggaag
gtatctccaattcttataattcttggattgttcataattggtattgttttccacttgatc
ggtttaatgtag

DBGET integrated database retrieval system