KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0724Help
Entry
Cbei_0724         CDS       T00547                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(870225..871526)
Genome map
AA seq 433 aa AA seqDB search
MSNFFYSPVIGIDVSADFSYTAILAPNGDIYKKSFKIKHDLNGFNHLVNEIKKVEEEFNM
KTAIFMESTGVYHLSLFHYLNKYFDNTFVINPLVTKSNKNGDIRKVKNDKKDALSIATIG
KFQNIKLSQQLSLDIFLLKNLVREYYKLTDTSSTFKKKLSADLRVIFPGYNTIFSDSTSK
SSIELLSQYPTPQSILEAPKENIIKIFLDSSKKGIIWSENTYSKLFKVANEAKIIGLPLD
GLAVKIASSITLIKTIQSEIDILLQKINNFIQSETFPESIRANIELIDSIPGIGQLTAIT
IIAEIGDIDGFLKPKHLVAFFGIDSSVNQSGNFKGDDNKISKRGTRIGRRALYSVALASI
RNNRNGVPINKVLLDYYQINLKGKKPKIALVAIMHKIINYIFAVLRNQTPFEQRDPKIHK
QMFLENNSLNKVA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattttttttatagtcctgtaataggaattgatgtttcagctgatttttcatat
actgcaatactcgcaccgaatggtgatatttataagaagtcatttaaaataaagcatgat
ctcaatggcttcaaccacttagttaatgaaataaaaaaagtggaagaagagtttaacatg
aaaactgcaattttcatggagtccactggcgtgtaccatttatctcttttccactatctt
aataaatatttcgataacacatttgttatcaatccactcgttactaagtctaacaaaaat
ggcgacataagaaaagtgaaaaatgataaaaaagacgctttatctattgcaacaatagga
aaatttcaaaacattaagttatcacaacaacttagccttgatatttttcttctgaaaaat
cttgtaagagagtattacaaacttacagatactagctctacttttaagaaaaaattatcc
gctgatttaagagttatttttcctggctataatactatattttcagattcaacatctaaa
agttcaattgagcttttaagtcaatatccaacgccacaatcaattttagaggcacctaag
gaaaatataattaagattttccttgatagctctaaaaagggcattatctggtcggaaaat
acatattccaaattatttaaggttgctaatgaagctaaaataattggcttaccgttagac
ggtttagccgtcaaaatagccagctctataacattaataaaaactattcaatcagagatt
gatatattgttacagaaaattaacaattttatacagtctgaaacttttcctgaatctatt
agagctaatattgaactaattgattcaattcctggcatagggcaattaactgctattact
ataatagctgaaataggtgatattgatggttttcttaagcccaaacatcttgtagctttc
tttggtattgatagctcagttaatcaatcaggtaattttaaaggcgatgataataaaatt
tcaaaaagaggaactcgaatcggtcgaagagcattatattctgttgcactagcttcaatc
cgtaacaatcgtaatggagttcctataaataaagtcctattagattattatcaaataaac
cttaaaggcaaaaagcctaaaatcgccttagtcgctataatgcataaaattataaactac
atttttgctgttctccgaaatcaaactccgtttgagcaaagagatcccaaaatacataag
caaatgttcctagaaaataactctttaaacaaagtcgcttaa

DBGET integrated database retrieval system