KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0732Help
Entry
Cbei_0732         CDS       T00547                                 

Definition
(GenBank) extracellular solute-binding protein, family 1
  KO
K10117  raffinose/stachyose/melibiose transport system substrate-binding protein
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe02010  ABC transporters
Module
cbe_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cbei_0732
Transporters [BR:cbe02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    Cbei_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6 SBP_bac_11 Glyco_hydro_47 LPAM_2
Motif
Other DBs
NCBI-ProteinID: ABR32916
JGI: Cbei0732
UniProt: A6LRD6
Position
880767..882017
Genome map
AA seq 416 aa AA seqDB search
MNKKLKLLMSITISAVIGTSLLAGCGSKGGSTENGKVKLELFSTKAENKTILQSLANEFQ
EKNPNIEISINSPANAGTVLKTRLAKNDMPDLVALGADVNYGALVDANALVDLTNDGIIE
NIQKPYLDMLHGIASNDNGKIYGVPYATNADGVLYNKDIFSKLGLQIPKTWDEFMAVSKK
IKDAGQLPLYLTLKDAWTGMCFWNVIASDLEPSNFLADKKAGKTTFEATHGEIVDKMENI
GTLGQEDILGVSYNDGNAAFAQGKSAMYLQGNWAISEIKKANPNINLGMFPLPASNDPSK
NNIVSGIDVLFGITSKSKHSDEAKKFIEFMTEKENAQKYIKDQFAFSAVKDVTQDDQSVT
DVQESFKNGKIGVFPDHYYPSSFDAASLVQGFYSKKDKAEFLKQLDTEYDKANSKQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaattaaaattactaatgtcaattactattagtgcagtaattggaacttca
ttattagcaggatgtggttctaagggaggcagcacagaaaatggaaaagtaaaattagag
ttattttcaactaaggcagaaaataaaacaatattacaatcattagcaaatgaatttcaa
gaaaagaatcctaatattgaaatttcaattaattcacctgcaaatgctggtactgtttta
aaaacaagacttgctaaaaatgatatgccagatttagtagctttaggtgcagatgtaaac
tatggtgcactagtagatgcaaatgcccttgttgatcttactaatgatggcattattgaa
aacatacaaaaaccatatttagatatgcttcatggcatagcaagtaatgataatggaaag
atatatggagttccatatgctactaatgctgatggcgttctatacaataaagatatattt
tcaaagctaggattgcaaattcctaaaacatgggatgaatttatggctgtatcgaaaaag
attaaagatgcaggtcaattaccactttatttgacacttaaagatgcgtggactggaatg
tgtttctggaatgtcatagctagtgacttggagcctagtaatttcttagctgataaaaaa
gcaggaaaaacaacttttgaagctacacatggagaaatagtggacaaaatggagaatata
ggaactcttgggcaagaagatattttaggagtatcatacaatgatggtaatgcagccttt
gcacaaggtaaatcagcaatgtatttacaaggtaactgggctattagtgaaataaaaaaa
gcaaatcctaatataaatctaggtatgttcccattacctgcaagtaatgatccatctaaa
aataatatagtatctggtatagatgtgttatttggaataacaagtaagtcaaaacattct
gatgaagcaaaaaaattcatagaatttatgactgaaaaggagaatgctcaaaaatatata
aaagatcaatttgcattttctgcagttaaagatgttacacaagatgatcaaagtgtaaca
gatgtacaagaaagctttaaaaatggaaaaattggtgttttccctgatcactactatcca
agctcatttgatgcagcaagtttagttcaagggttctatagtaaaaaagataaggcagaa
ttcttaaaacaacttgatactgaatacgataaagctaatagcaagcaataa

DBGET integrated database retrieval system