KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0748Help
Entry
Cbei_0748         CDS       T00547                                 

Definition
(GenBank) deoxyribose-phosphate aldolase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC NanE QRPTase_C IMPDH
Motif
Other DBs
NCBI-ProteinID: ABR32932
JGI: Cbei0748
UniProt: A6LRF2
Position
complement(904649..905353)
Genome map
AA seq 234 aa AA seqDB search
MIPTKKAAEMTIEELGSYIDQSVLKPEFTLDQIRKYIQKGVDYKCKTVCVYPSSINIAKE
LTAETQTGICVVCDFPFGTSATSSKILQAEECCKQGIDELDIVANCGWTRSNLWHSVEAD
IKAVVDVCHDYDILVNAIFETDALTLDQIKKSTEVAISAGVDFIKTSTNFLTGFASKGAT
PETIKIIMDTAKDRCKIKASGAIKTREHFLKLIDMGIDRIGIGYKSTPVVLGLS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgataccaacaaaaaaagctgccgaaatgactatagaggaattaggatcttacattgat
caatcagtgctaaagccagaatttactttagatcaaattagaaagtatattcaaaaaggt
gtagattataaatgcaaaacagtttgtgtctatccatcctcaataaatattgctaaagag
ttaacagctgaaactcaaactgggatatgtgttgtatgtgattttccttttggtacatca
gcaacatcctcaaaaattttacaagcagaagaatgctgcaagcaaggaattgatgagctt
gatatagttgcaaattgtggctggacacgaagtaatttgtggcactcagttgaggctgat
ataaaagctgtcgttgatgtgtgtcatgattatgatattcttgtaaatgcaatttttgaa
actgatgctctaacattagatcaaataaaaaaatctacagaagtcgctatttcagctggt
gttgattttattaagacatcaactaattttctaacaggatttgctagcaaaggtgctacc
cctgaaaccataaaaataataatggatactgcaaaggatcgctgtaaaattaaggcctca
ggtgccataaagacaagagagcactttctaaaattgattgatatgggaattgatagaatt
gggataggatataaatctactcctgttgtcttaggtctttcataa

DBGET integrated database retrieval system