KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0759Help
Entry
Cbei_0759         CDS       T00547                                 

Definition
(GenBank) Serine--pyruvate transaminase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABR32943
JGI: Cbei0759
UniProt: A6LRG3
Position
918844..919989
Genome map
AA seq 381 aa AA seqDB search
MNEKFVYAPGPTNVRENVRLERARITTNPDVDEEFVEFYKNTCDKIGKIIETKNPVYILS
GEGILGLEAACASLTEPGDRVLVLDNGIYGRGFKDFVEMYGGEGVYFSCDYNKAIDESKL
NEFLSVDHDFKYATIVHCDTPTGVLNDLSKICPLLNEYGILTVVDSVSAMGGEEIRVDDW
KIDIALGGSQKAFSAPAGLTMVSISEKAKEAMKNRKTPVIGFYCNLNIWENYYANKWFPY
TMPISDIMGLDKAVDNILDEGIQNVLKRHEKIAYATRKAVSEFGLELFLEDGYSNTVTAV
KIPENIGAQRLKNHMLSKYNTLIITSLNPYEDIILRIGHMGENAKVDKILYALNIIENGL
KDLGFESNGELVNSFIRHLNN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaaatttgtttatgctccgggtccgacaaatgttagagagaatgtaaggtta
gaaagagctaggataactactaatccagacgtagacgaagaatttgtggaattctataaa
aatacttgtgataaaatagggaaaataattgagacaaaaaatccggtatatatactaagt
ggggaaggtattttaggattagaagcggcatgtgcatctcttactgaaccaggtgataga
gtacttgttttagacaatggaatttatgggagaggttttaaggactttgttgaaatgtac
ggaggagaaggggtatatttttcgtgcgattataacaaagctatagatgaaagtaagtta
aatgaatttttaagtgtggatcatgattttaagtatgcaacaatagttcattgcgatacg
ccaacaggagttttaaatgatttatctaagatatgcccattattaaatgagtatggaatt
ttaactgttgttgattctgtttctgcaatgggtggagaagaaataagggttgatgattgg
aagattgatatagcattaggtggatctcagaaagcattttcagctccagcgggattaact
atggtaagcatcagcgaaaaagctaaagaagcaatgaaaaatagaaagactccagtaata
gggttttactgtaatcttaatatctgggaaaattattacgcaaataagtggtttccgtac
acaatgccaataagtgatatcatggggttagataaagcggttgataatattttggacgaa
ggaattcaaaatgtacttaaaagacatgaaaaaatagcatatgcgactaggaaggctgtt
agtgaatttggacttgaattatttttagaagatggttattcaaatacagtaacagcagtc
aaaataccggaaaacataggagctcagaggcttaaaaatcatatgttgagtaaatacaat
actttaattataacatcactaaatccatacgaagatataattttaagaataggacacatg
ggggagaatgcaaaagttgataagattctttatgcattaaatataattgagaacggacta
aaagatctaggctttgaaagtaatggtgaattagtaaattcatttattagacacttaaat
aattaa

DBGET integrated database retrieval system