KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0777Help
Entry
Cbei_0777         CDS       T00547                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Cbei_0777
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cbei_0777
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cbei_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
945277..945756
Genome map
AA seq 159 aa AA seqDB search
MNFYSFSANKMNGQEVKMEEYKGKVVLIVNTASKCGFTPQFEELEDIYKEYKDQGLEILG
FPCNQFAKQDPSSNEEINSFCKLNYGVTFTMFEKIDVNGTSAHPLYEFLKNKKRGLFNKD
IKWNFTKFLVNKDGEVIGRYSPTTKPSKIKEDIINLLNA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatagtttttctgcaaataaaatgaatggtcaagaagtaaaaatggaagaa
tataaaggaaaagtagttttaatagtaaatactgcgagtaagtgcggatttacaccacaa
tttgaagagttagaagatatttataaggaatataaagatcagggattagaaatattaggt
tttccatgcaatcagtttgccaaacaagatccatctagcaatgaggaaataaattcgttt
tgcaaattaaattatggagttacttttaccatgtttgagaaaattgatgtaaatggaact
agcgcacatccgctatatgaattcttgaaaaataaaaaaagaggactctttaataaggat
ataaaatggaattttactaagtttttagttaataaagatggagaagttatagggcgatat
tctccaacaacaaagccatcaaaaattaaagaagatattataaatttgttaaatgcttaa

DBGET integrated database retrieval system