KEGG   Clostridium beijerinckii: Cbei_0998Help
Entry
Cbei_0998         CDS       T00547                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbe  Clostridium beijerinckii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cbei_0998
   01230 Biosynthesis of amino acids
    Cbei_0998
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_0998
   00030 Pentose phosphate pathway
    Cbei_0998
   00051 Fructose and mannose metabolism
    Cbei_0998
   00052 Galactose metabolism
    Cbei_0998
  Energy metabolism
   00680 Methane metabolism
    Cbei_0998
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cbei_0998
Protein phosphatases and associated proteins [BR:cbe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cbei_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1196228..1197325
Genome map
AA seq 365 aa AA seqDB search
MSKDIKKIALLTGGGDCPGLNAVISAVTKSAILNYGYEVIGYKFGYRGLYNNDFISLDLG
AVSGLISRGGTILYSSNKDNLFDYSVEENGQIVKKDVSDVAVENLKKEGVDVLVVIGGDG
TLTSARDFSRKGVNVIGVPKTIDNDLGSTDVTFGFNTAIGIATEALDRLHTTAESHHRIM
ILEVMGRNAGFIALESGIAGSADVILLPEIPYDINKVVEKIEDRKKHGKLFTIIVVAEGA
KPKNGDVIVSKIVEDSPDPIRLGGIGNKIAEDLEKLVKDREVRCTVLGHIQRGGTTSTYD
RILSTRYGVEAIELINKGKFGSMVCLKGNEITYDSLENVIGNNKKVDQDGELVAVAKRIG
ISFAD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagatattaaaaagatagctctattaactggaggaggagattgcccaggctta
aatgcagtaataagtgcagtaacgaaatcagcaattttaaattatggatatgaagttatt
ggatataaattcggttacagaggattatataacaatgattttatttcattagatttagga
gctgtatcaggccttatatcaagaggaggaacaattctttatagttcaaataaagataat
ttgtttgattactcagtagaagaaaatggtcaaatagtaaaaaaagatgtatccgatgta
gcagttgagaatttaaaaaaagagggtgtagacgttttagttgtaattggtggagatgga
acattaacatcagctagagatttttcaagaaaaggagtaaatgttattggcgttccaaag
actatagataatgatttagggtcaactgatgtaacgtttggctttaatacagctataggt
atagcaacggaagcattagatagactgcatacaactgcagaatctcatcatagaattatg
attctagaagttatgggaaggaatgcaggttttatagcattggaatcaggaatagctggt
tcagcagatgttatactactacctgaaattccatatgatataaataaagttgtagaaaaa
attgaagatagaaaaaaacatggaaagttattcactataattgttgtagcagaaggtgca
aaacctaagaacggcgatgttatagtatctaagatagttgaagatagtccagatccaatt
agacttggtggtattggaaataagatagctgaagatttggaaaagttagttaaggataga
gaagttagatgtacagttcttggtcatattcaaagaggtggaactacatcaacatatgat
agaatattatcaacaagatatggtgttgaagcaatagagcttatcaataaaggtaagttc
ggaagcatggtatgcttaaaaggtaatgaaattacttatgatagtttagaaaatgtcatt
ggtaataacaagaaagtagatcaagatggagagttagtagctgtagctaagagaataggg
atatcatttgccgattag

DBGET integrated database retrieval system