KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1034Help
Entry
Cbei_1034         CDS       T00547                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cbei_1034
Enzymes [BR:cbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cbei_1034
Peptidases [BR:cbe01002]
 Cysteine Peptidases
  Family C44
   Cbei_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1238543..1240387
Genome map
AA seq 614 aa AA seqDB search
MCGIAGLVNFKKNIVQDKDILNNMIKTLEKRGPDAKGYYISPNVLLGHRRLIVVDPEGGL
QPMTKIFEGKKYTLVYNGELYNTEDLRKELKAKGFTFDSYSDTEVLLTSYICWGKDCVNK
LIGIFAFGVFDEDKREVFLARDQMGVKPLFYTVHDNTLVFGSEIKTLLADPRVKREIDME
GLTEIFGLGPATIPGSGVFKNIKEIAPANCLLVSGDGNIKKWEYWTVEAKEFHETAEEAI
VHARELLIDAVKRQLVGDVPVCTFLSGGLDSSIISAIAAEEFRKQGKKLTTYAINYEDNE
KYFKASLFQPTSDEYWSEEMAKFINSDHRKVVLNHSDLAAALRDAVISRDLPGMADIDSS
MLLFCKEIRKDFVVGLTGECADEIFGGYPWFTRDEMFYLDTFPWSRFVNDRKAIVNKKLK
NMPLEELVRTQYEKSLSKVPHLDGESKRDYRMREVSYLNLKWFMVQLLTRKDRTSMYNGL
EARVPFADIRLVDYAFNLPADVKLYKGREKGLLRAAFEGILPNDIIYRKKSPYPKTHNPV
YTDIVCKMITEILDKKSSPIHEIIDEKVVREIILTKGESYKAPWYGQLMTGPQLLAFLIQ
VNIWLEEYNVNLLI
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgctggattagtaaattttaaaaagaatatagtacaagataaagatata
ttaaataatatgataaagactttggagaagaggggacctgatgcaaaaggatattatata
tctccaaatgttttattaggccatagaaggcttatagttgtagatccagaaggtggattg
caacctatgactaaaatatttgagggtaagaaatacacattggtttataatggtgagcta
tataatactgaggatttaagaaaagaattaaaggctaaaggatttacttttgattcttat
tcagatactgaagtattgcttacatcgtatatttgttgggggaaggactgtgtaaataag
cttataggtatatttgcatttggagtttttgatgaagataaaagagaagtttttttagct
agagatcaaatgggggttaagccattattctatactgttcatgataatacccttgttttt
ggttctgagataaaaactcttttagcagatccaagagttaaaagagaaattgatatggaa
ggattaactgaaatatttgggcttggacctgcgacaataccaggaagcggagtatttaag
aatataaaagaaattgcaccagccaactgtttattagtttcaggtgatggaaacattaaa
aagtgggaatattggacagttgaagcaaaagaatttcatgaaacagcagaagaagcaata
gttcatgcgagagaattattaatagatgcagtaaagagacaattagttggagatgtacct
gtttgtacattcctatcagggggattagactcctcaattatatcagcaatagctgctgag
gaatttagaaaacagggaaagaagcttactacttatgcgattaattatgaagacaatgaa
aagtattttaaagcgtcattatttcaaccgacatcagatgaatactggtcagaagaaatg
gcaaagtttataaatagtgatcatagaaaagtagttttgaatcattcagatttagcagct
gcattaagagatgctgtgatatcaagagacttacctggtatggcagatatcgattcatca
atgcttctattttgtaaagaaattcgtaaagactttgtagttggacttacaggagagtgt
gctgatgaaatctttgggggatatccttggtttacaagggatgaaatgttctatttagat
acattcccatggtcaaggtttgttaatgatagaaaggctatagttaataagaaattaaaa
aatatgccgctagaggaattagttagaactcaatatgaaaaatctctaagtaaagtccct
catcttgatggggagagtaagagagattataggatgagggaagtgtcatatttaaatcta
aaatggttcatggttcagcttcttacaagaaaagataggactagtatgtataatggacta
gaagcaagagttccatttgccgacattagattggttgattatgcgttcaacttgccagct
gatgtaaaattatataaaggcagagaaaaaggattattaagagcagcctttgaaggaata
ttaccaaatgacattatatacagaaagaagagtccatatcctaagacacataatccagtt
tatacagacattgtatgtaagatgataactgagattttagataagaaatcttcaccaatt
catgaaatcattgatgaaaaggtagttagagagataatactcacaaaaggagaatcatat
aaagctccatggtatgggcagctaatgactggaccacaattgcttgctttcttgattcaa
gtaaatatttggcttgaagaatataatgttaatctactaatttaa

DBGET integrated database retrieval system