KEGG   Clostridium beijerinckii: Cbei_1232Help
Entry
Cbei_1232         CDS       T00547                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cbe  Clostridium beijerinckii
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbe00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1458390..1460483
Genome map
AA seq 697 aa AA seqDB search
MKKEFPVLNSKINGFLHGGDYNPDQWLNYPEVLKEDVRLMKLANCNCVSINIFGWSAIEP
EEGKYTFEWLDKIMNDMAENNIHVILSTPSGARPAWMSEKYPEVLRVNSDRCKNLHGQRH
NHCFTSPVYRKKTYEINKILAERYKDHPALIMWHVSNEYGGECHCDLCQDAFREWLKRKY
DNNLDKLNEAWWTGFWSHRFNSWSQIESPSEKGEMFVHGHNLDWKRFVTDQTIDFYKNEI
APIREITPNIPVTANFMGNYPRMGLFTGLDYWKFAKEVDVVTWDNYPAWHNDFESTEDLA
ANVSFVHDIYRSLKGGHPFLIMESTPSLVNWHDTNKLKRPGMHLLSSMQGVAHGADSVLY
FQWRKGRGASEKFHGAVVDHCGHENTRVFREVTEVGEVLKKIKEIQGSIKESEVAIIFDV
ENLWAIDDAQGLKKYRKGYEESCQAAYKVFWENGISVDIINMDCDISDYKLVIAPMLYMI
RPNVAERINEFVKTGGTFVTTYFSGMVDENDLCFLGGFPGPLREVTGIWSEEIDSLYDNE
VNYIEFKNDKIKELKSQYEVKDYCDLIHVETAEVLGVYKEDFYADMPALTVNNYGDGRAY
YISARTGADFNNDFYSKLFKDLDIKSVIEGELPQGVTAQMRSNKNNKYTFIMNFTEEEKK
VDLGEEIYFDMLSGEEISGKIILGKYGLKILKQINCN
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaatttccagtacttaatagtaaaataaatggatttttacatggcggtgac
tataatccagatcaatggctaaactatccggaagtgttaaaagaagatgtgcggcttatg
aaacttgcaaattgcaattgcgtatcaataaacatatttggctggagtgcaatagagccg
gaagaaggaaaatatacatttgagtggttagataaaattatgaatgatatggcagaaaac
aatattcatgtaattttatctactccaagtggtgcaagacctgcatggatgtcagaaaaa
tatccagaggtcttaagagtaaatagcgatagatgtaaaaatcttcatggtcagagacac
aatcattgttttacctcacctgtttatagaaaaaagacatatgaaataaataaaattctt
gctgagagatataaagatcatccggcgcttattatgtggcatgtttctaacgaatatgga
ggagaatgtcactgtgatctatgtcaagatgcttttagagaatggcttaaaagaaagtac
gataataatttagataaattaaatgaggcttggtggactggtttctggagtcatagattt
aacagttggtcacaaatcgaaagtccgtctgaaaagggtgagatgtttgttcatggacat
aatttagattggaagcggttcgttacagatcagacaatagatttttataaaaatgaaatt
gcccccataagagaaataacacctaacatacctgtaacagctaatttcatgggtaattat
ccacgtatgggcttgttcacaggtttagattattggaagtttgcaaaagaagtggatgta
gttacatgggataactatcctgcatggcataacgattttgaaagtactgaagatcttgca
gctaatgttagttttgtgcatgatatatataggtcgttaaaaggtggacatccgttttta
ataatggaaagtactccgagtctagtaaattggcatgatactaataaattaaagcgccct
ggaatgcatttattatcatcaatgcaaggtgtggctcatggagcagattctgttctgtat
ttccaatggagaaaaggaagaggagcttcggaaaaattccatggtgctgttgtagatcac
tgtggccatgagaatacaagagtatttagagaagttacagaagttggagaagtcttaaaa
aagattaaagaaatccaagggtcaattaaagaatcagaagtggccataatatttgatgtt
gaaaacttatgggctatcgatgatgcacagggattaaaaaaatatagaaagggctatgaa
gaaagctgtcaagcagcttataaagtattttgggaaaatggaatttcagtagatattatt
aatatggattgtgatatatcagattataaacttgtaatagcaccaatgctatatatgata
agaccaaatgttgcagaaagaattaatgaatttgtaaagacaggcggaacttttgtaact
acttattttagcggaatggtggatgaaaatgatctttgcttcttaggaggatttccagga
ccacttcgagaagtaactggaatttggtcagaagaaatagattcactatatgataatgaa
gtgaattatatagaatttaaaaatgataaaattaaagaattaaagagccaatatgaagta
aaagattactgtgacttaatccatgtagaaactgcagaagttcttggagtatataaagaa
gatttttatgcggatatgcctgcgttaacagttaataactatggagatggaagagcatat
tatatttcagcaagaacgggagcagattttaacaatgatttttattcaaagctttttaag
gatttagatattaagagtgttatagagggagaattgccacaaggtgttacagctcaaatg
cgttccaataaaaataataagtatactttcattatgaatttcactgaagaagaaaaaaag
gtggatttaggagaagaaatatattttgatatgctttctggagaagaaatcagtggaaag
atcatattaggtaagtatggtctaaaaatactaaagcaaattaattgtaattaa

DBGET integrated database retrieval system