KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1286Help
Entry
Cbei_1286         CDS       T00547                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cbei_1286
Enzymes [BR:cbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cbei_1286
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cbei_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1519796..1521259
Genome map
AA seq 487 aa AA seqDB search
MSKVYIIGTGPGDEELLTLKAVKVLKRCTAVLYDRLVSNNVLNYLEPNCEIYYCGKEPGA
HSKTQEEINELLVKLAKEGHTVGRIKGGDPYVFGRGGEEVLALVDENIEFEVIPGVTSPI
AVLNYAGIPITHRKIAQSFHVITGKSAQDLNVNFKALAKEEGTLVFMMGLGNLDNIVEEL
INNGKEPIFPCAVVMRGTSAKQKKVVGTLENISQKVKDAKLQSPCIIVVGEVVNLNKDLN
WYENKPLFGKNICITRSRRQSEKLKNKLVDLGAEVTSFNSIKIESSAENLNDYIEKIENY
DHMVFTSVNSVEIFFDYLIEKDYDIRRIKAKISAIGAATANSLKQRGIICFAKAREFVGE
GLVSILKPHLKDNQTLLLPCSAKSRKYIYEELTNCGASVDKVYIYDTVCGSVVNKRSFDE
VDIVFFTSPSTVENMIDMLGIEEIKKKQVIAIGPKTNEPLEKYGIKAYVCKEHSEEGFLK
EIENLLQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtatatataataggtacaggtccaggagatgaagagttattaacattaaag
gctgtcaaggtattaaaaagatgtactgctgttctttatgatagattggtttcaaataat
gttttgaattatctagaaccaaattgtgaaatttattattgtggaaaggaaccaggagct
cattcaaaaactcaagaggagattaatgaacttttagttaaacttgcaaaagaagggcat
acagttggaagaattaaaggtggagacccatatgtttttggaagaggcggagaagaggta
ttggctttagttgatgaaaatatagaatttgaggtaataccaggggtaacatctcctatt
gcagttttaaattatgcaggaatcccaataactcacagaaagatagcacaaagttttcat
gttataacaggaaaatctgcgcaagatttaaatgtgaattttaaggctctagctaaagaa
gaaggcacattagtatttatgatgggattaggcaatttagataatatagtggaggagctt
attaataatggaaaagaaccaattttcccatgtgcggtagtgatgagaggaacttcagct
aagcaaaaaaaggtagtaggaacgcttgagaatatttcacaaaaagtaaaagatgctaaa
ttacaatctccatgtataattgttgttggtgaagttgtaaatttaaataaagatttgaac
tggtatgaaaataaacctttgtttggaaagaatatatgtattacaagatcaaggagacaa
tctgagaaattaaaaaataaattagttgacttaggagcggaagttacaagttttaattct
attaagatagaaagcagtgcggaaaacttaaatgattatatagagaagatagaaaattat
gatcatatggtatttacttcagttaatagtgtagaaatattttttgattatcttattgaa
aaagattatgatataagaagaattaaagctaaaatatccgcaataggcgctgctactgca
aattctttaaaacaaagaggaattatctgttttgcaaaggccagagaatttgttggtgaa
ggtttagtgagcatattaaaacctcatttgaaagataaccaaactctacttttgccgtgt
tctgcaaaaagtaggaaatatatttatgaagaactaacaaattgtggtgcaagtgtagat
aaagtatatatatatgatacggtttgtggatcagtagttaataagagatcttttgatgaa
gttgacatagtattcttcacaagtccgtcaacagttgaaaacatgattgatatgttaggg
attgaggaaattaagaaaaagcaggttatagctataggaccaaagactaatgaaccttta
gaaaagtacggaataaaagcatacgtatgtaaagaacactcagaggaagggtttctgaaa
gagatagaaaatttactgcaatag

DBGET integrated database retrieval system