KEGG   Clostridium beijerinckii: Cbei_1287Help
Entry
Cbei_1287         CDS       T00547                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cbei_1287
Enzymes [BR:cbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cbei_1287
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cbei_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1521358..1522323
Genome map
AA seq 321 aa AA seqDB search
MIKRGRRLRVNAAIRDMVRETSLDSKDFIYPIFVVEGDNIKNEISSLPDVYHYSVDRLYE
VVEEVREANISGVLLFGIPNHKDECGSESYNDNGIVQQAIREIKKLDKELLVITDVCMCE
YTSHGHCGIIHDEYVDNDETLEYLSKIAVSHAKAGADIIAPSDMMDGRIGSLRSALDENN
FKNVSIMSYSAKYCSAFYGPFRDAANSAPQFGDRKTYQMDPGNRMEAIRETQMDVEEGAD
FIMVKPALSYLDIIRDCKENFNLPLVAYNVSGEYAMIKAAGKLGVIDEERVMMETLTSIK
RAGADIIITYHALEAAKVLRR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagaggtagaagacttagagttaatgctgccattagagatatggtaagagaa
acaagtttagattcaaaggattttatttatccaatttttgttgttgagggagacaatata
aaaaatgaaatttcatcactgccagatgtttatcattattcagttgatagattgtatgaa
gtagttgaagaagttagagaagctaatatttctggagtattactttttggaattccaaac
cataaagatgagtgtggttctgaaagttataatgataatggaattgttcaacaggcaata
agagaaataaagaagcttgataaagaattgcttgttattactgatgtttgtatgtgtgaa
tacacttcacatggacactgtggaataatccatgatgaatatgtagacaatgatgaaaca
ttagaatatttaagtaaaatagcagtatcacatgcaaaggcaggtgcagatattatagct
ccttcggacatgatggatggaagaattggatcattaagaagtgcattagatgaaaataac
tttaagaatgttagcataatgagttattctgctaaatattgctcggcgttttatggacca
ttcagagatgcggcaaattcagcgccacaatttggagatagaaagacatatcaaatggat
ccaggaaatagaatggaagccattcgtgaaacgcaaatggatgtagaagaaggagcagat
ttcattatggttaagccggcactttcttacctagacataataagagattgtaaagaaaat
ttcaatcttcctcttgtggcttataatgtaagtggtgagtatgctatgattaaagcagct
ggaaagcttggcgttattgatgaagaaagagtaatgatggaaactttaacatcgattaag
agagctggagcagatataattattacttatcatgcattagaagcagcaaaagttctaaga
agataa

DBGET integrated database retrieval system