KEGG   Clostridium beijerinckii: Cbei_1287Help
Entry
Cbei_1287         CDS       T00547                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbe  Clostridium beijerinckii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1521358..1522323
Genome map
AA seq 321 aa AA seqDB search
MIKRGRRLRVNAAIRDMVRETSLDSKDFIYPIFVVEGDNIKNEISSLPDVYHYSVDRLYE
VVEEVREANISGVLLFGIPNHKDECGSESYNDNGIVQQAIREIKKLDKELLVITDVCMCE
YTSHGHCGIIHDEYVDNDETLEYLSKIAVSHAKAGADIIAPSDMMDGRIGSLRSALDENN
FKNVSIMSYSAKYCSAFYGPFRDAANSAPQFGDRKTYQMDPGNRMEAIRETQMDVEEGAD
FIMVKPALSYLDIIRDCKENFNLPLVAYNVSGEYAMIKAAGKLGVIDEERVMMETLTSIK
RAGADIIITYHALEAAKVLRR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagaggtagaagacttagagttaatgctgccattagagatatggtaagagaa
acaagtttagattcaaaggattttatttatccaatttttgttgttgagggagacaatata
aaaaatgaaatttcatcactgccagatgtttatcattattcagttgatagattgtatgaa
gtagttgaagaagttagagaagctaatatttctggagtattactttttggaattccaaac
cataaagatgagtgtggttctgaaagttataatgataatggaattgttcaacaggcaata
agagaaataaagaagcttgataaagaattgcttgttattactgatgtttgtatgtgtgaa
tacacttcacatggacactgtggaataatccatgatgaatatgtagacaatgatgaaaca
ttagaatatttaagtaaaatagcagtatcacatgcaaaggcaggtgcagatattatagct
ccttcggacatgatggatggaagaattggatcattaagaagtgcattagatgaaaataac
tttaagaatgttagcataatgagttattctgctaaatattgctcggcgttttatggacca
ttcagagatgcggcaaattcagcgccacaatttggagatagaaagacatatcaaatggat
ccaggaaatagaatggaagccattcgtgaaacgcaaatggatgtagaagaaggagcagat
ttcattatggttaagccggcactttcttacctagacataataagagattgtaaagaaaat
ttcaatcttcctcttgtggcttataatgtaagtggtgagtatgctatgattaaagcagct
ggaaagcttggcgttattgatgaagaaagagtaatgatggaaactttaacatcgattaag
agagctggagcagatataattattacttatcatgcattagaagcagcaaaagttctaaga
agataa

DBGET integrated database retrieval system