KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1293Help
Entry
Cbei_1293         CDS       T00547                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cbei_1293
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cbei_1293
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cbei_1293
Enzymes [BR:cbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cbei_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1528035..1529492
Genome map
AA seq 485 aa AA seqDB search
MKFRSTRGLDKNIESARAIINGISKDGGLYVPDEFPKVYDELKEDTHIKYEDLAFKVINE
FFTDIDDAELTGAINDAYNDRFSVEVKNNFLELYHGPTCAFKDAALLFLPQIMKRAKKIC
DVKEDITILTATSGDTGKAALEGFKNIDGFKVVVYYPKNGVSAIQERQMSSQEGNNVKVI
GIKGNFDDAQTGVKEIFGDNEFREGLSQKGFILSSANSINIGRLVPQIVYYFYGYFNLVN
QGVIQKDDPINVVVPTGNFGNILAGYYAKQMGLPIDKFICASNENKVLTDFFETGVYDKK
RELILTESPSMDILVSSNLERLLFEASGRDTEVVSKLMEDLTTKGVYEVNEKIKSFIKEF
YGNFATTEEVYDAIKEVYKKDNYLMDTHTAVAYVVKKKYIEETKDDKPTLILSTASPFKF
PRSICNALDIDVEGLDDFKVLNKLSDSTNNKIPNSLSTLENAKVIHDEVWDKSEMRNALL
SYLDS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagaagtactaggggtctggataagaatatagaatctgctagagcaataatt
aatggaatttcaaaagatggcggattgtatgttccagatgaatttcctaaagtctatgat
gaattgaaggaagatacgcatattaaatatgaagatctagcatttaaagttatcaatgag
tttttcacagatattgatgatgcggaattaactggggcaattaatgacgcatataatgat
agatttagtgtggaagtaaagaacaattttttagaattatatcatggaccaacttgtgca
tttaaggatgcagcgttattatttttaccacaaatcatgaaaagagctaaaaagatttgt
gatgttaaagaggatataacaattcttacagcaacttcaggagatacaggaaaagctgca
cttgaaggttttaaaaatattgatggttttaaagttgtagtttattatcctaagaatggt
gttagtgcaattcaggaaagacaaatgtcaagtcaagaaggaaacaatgttaaggtcatt
ggaataaaggggaatttcgatgatgctcagacaggcgtaaaagaaatcttcggagataat
gaattcagagaagggctatctcaaaaaggatttatcttatcatcggcaaactccattaat
attggaagattagtacctcaaatagtgtattatttttatggatattttaatttagtgaac
caaggagtaatacaaaaagatgatcctataaatgttgtagttcctacaggaaattttgga
aacatattagcaggatattatgctaagcaaatgggattaccaatagataaatttatatgt
gcatcaaatgaaaataaagttcttacagatttctttgaaactggggtatatgacaagaaa
agagaacttattttaacagaatcaccgtctatggatatacttgtttcatctaatcttgaa
agattattatttgaagcaagcggtagagatactgaagttgttagcaaattaatggaagat
ctaactactaaaggtgtttatgaagtaaacgaaaaaattaaaagcttcataaaagaattt
tatggaaactttgcgactacagaagaagtgtatgatgctataaaggaagtttataagaaa
gataattacttgatggatactcatacagcagtggcatatgtagttaaaaagaagtatata
gaagaaactaaagacgacaaaccaactttaatactttcaacagcaagtccgtttaaattc
ccaagaagtatttgtaatgcacttgatattgatgtagagggattagatgatttcaaagta
ttaaataaattatctgattcaacaaataataaaataccaaatagtttaagtactttggaa
aatgcaaaagtaatacatgatgaagtttgggataagagtgaaatgagaaatgctctatta
tcttatttggattcatag

DBGET integrated database retrieval system