KEGG   Clostridium beijerinckii: Cbei_1317Help
Entry
Cbei_1317         CDS       T00547                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cbe  Clostridium beijerinckii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbe01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cbe00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1554454..1555752
Genome map
AA seq 432 aa AA seqDB search
MLNLMEITESNKESLISELKGRVTETEQEIISSVNSILSRVKKDGDKALFELTKSFDKVE
LKTLEVSTFEIDECFNKVEKEFIEALEEAKANIKEYHEKQKSNGFLMTKDKGVYLGQRVL
PLERVGVYVPGGTAAYPSSVLMNVIPAKVAGVDEIVMVTPPDKNGGINPYIGVAARIAGI
NKIYKVGGAQAVAALAYGTESIKKVDKIVGPGNIFVATAKKLVFGEVDIDMIAGPSEILV
IADEKSNPCFVAADLMSQAEHDKLASSILITTSKELHKRVEMELERQVKTLEREEIIRTS
LENFGSAIICRTIEECIDISNSIAPEHLELMVDDPMKYLGMVRNAGSVFLGRYCPEPIGD
YFGGTNHVLPTSGTARFFSPLSVDSFIKKSSFIYYSEEALMENGEKIITLASKEGLTAHA
NSVKVRLENGNV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatttaatggagattaccgagagtaataaagaaagcttaattagtgaacttaaa
ggtagagttacagaaacggaacaagagataatctcaagtgtaaatagtattctatcaaga
gtgaaaaaagatggggataaagctttatttgaacttacgaagtcatttgataaggttgaa
cttaaaactttagaagtatcaacttttgaaattgatgaatgttttaataaagtggagaaa
gagttcattgaagcattagaagaagctaaagcaaatataaaagagtatcacgaaaaacaa
aaatcaaatggatttttaatgacaaaagataaaggagtatacctagggcagagagtattg
cctttagaaagagttggagtttatgttccaggtggaactgctgcttatccatcatcagtg
cttatgaatgtaatacctgcaaaagtagcaggagtagatgaaattgttatggtaactcca
ccagacaaaaatggagggattaatccatatattggagtggctgcaagaatagcaggaatt
aataaaatatataaagttggaggagcacaagctgttgcagctttggcttatggaacagag
agcattaaaaaggttgataaaattgttggaccaggaaatatatttgttgctactgcaaag
aaattagtatttggagaagttgatatagatatgattgcagggccaagtgaaatattagtt
attgctgatgagaaatctaatccgtgttttgtagcagcagatttaatgtcacaggcagag
catgataaattagcatcatcaatattaatcacaacatcaaaagaattacacaagagagtt
gagatggagttggaacgacaagtaaagactcttgaaagagaagaaataataagaacttcc
cttgaaaattttggaagtgcaataatttgtagaacaatagaagaatgtattgacatttct
aattctatagctccagagcatttagagctaatggtagatgatccaatgaaatatttaggt
atggttagaaatgcagggtctgtatttttaggaagatactgtccagagcctataggagat
tattttgggggaacaaatcatgtattacctacaagtggtacagcaaggttcttttcaccg
ttatcagttgatagttttataaaaaaatcttctttcatttattattcagaagaagcactt
atggaaaatggagaaaaaattataacattagcaagcaaggaaggacttacagctcatgct
aattccgtgaaagtgagattagagaatgggaacgtataa

DBGET integrated database retrieval system