KEGG   Clostridium beijerinckii: Cbei_1530Help
Entry
Cbei_1530         CDS       T00547                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cbe  Clostridium beijerinckii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1804938..1805534
Genome map
AA seq 198 aa AA seqDB search
MYEYIKGKYIGINKDYVIVENSGIGYKIFTSGATMSSMPKNGEEIMLYLEQIVREDFIGL
YGFDSKEELEMFKLLLTVSGVGPKAALSLLSISRVNNLKYAIMIGDEKHICRGVGIGKKT
AARIILEIKDKLKPDELVDSSLEIDTKDNENVMALSEALSALIALGYSEKEAESVLKKID
KNDSVENIIKNALKALMG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatataaaaggtaaatatattgggataaataaagattatgtaatagtagag
aatagcggtataggctacaagatatttacatcaggtgctacaatgtcctcgatgccaaag
aatggagaggagattatgctttaccttgagcaaatagtaagggaagattttattggatta
tatgggtttgattcaaaggaagagctagagatgtttaagcttcttttaacagtaagtgga
gttggaccaaaagcagcattatctttactatctataagcagagttaataatttaaaatat
gcaataatgattggcgatgagaaacacatctgtagaggtgtgggaatagggaaaaaaaca
gcagctagaattattttagagatcaaagataaactaaagccagatgaactagtggatagc
agtttggaaattgatacaaaggataatgagaatgttatggcattatcagaagctttaagt
gcgttaattgcgctagggtatagcgagaaggaagcagaatcagtacttaaaaagatagat
aagaatgatagtgtagaaaatatcattaaaaatgcattaaaggcgttgatgggataa

DBGET integrated database retrieval system