KEGG   Clostridium beijerinckii: Cbei_1727Help
Entry
Cbei_1727         CDS       T00547                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbe  Clostridium beijerinckii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cbei_1727
   00052 Galactose metabolism
    Cbei_1727
   00500 Starch and sucrose metabolism
    Cbei_1727
   00520 Amino sugar and nucleotide sugar metabolism
    Cbei_1727
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cbei_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1999640..2000530
Genome map
AA seq 296 aa AA seqDB search
MNVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVESGIEEILIITGRNK
RAIEDHFDKSVELEDELENSKKDELLKMVQSISNMVDIYYTRQKEPKGLGDAISHAKNFV
GNEPFAVMLGDDIVDNEVPCLKQLINCYDKYKTSVLGVQEISECNIPKYGIIKGIEIDEG
LYKVSDMVEKPKIEEAPSNIAILGRYIITPDIFDILESTKPGKSGEIQLTDALKELTRQE
AVYAYCFEGKRYDVGDKLGYLQANIAFTLKRDDLKDDFITYLSDLRDRSANLDLIH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaagaaaagctgtaatacctgcagctggccttggaactaggtttttgccagca
actaaagcccagccaaaagaaatgttacctatagtagataaacctactatccaatatata
gtagaagaagcagttgaatctggcattgaggaaatacttataataacagggagaaataaa
cgggctatagaagatcattttgataaatctgtagagcttgaagatgagcttgagaatagt
aaaaaagacgagttgcttaagatggtacaaagtatatctaatatggtagatatttactat
acacgtcaaaaagaacccaaaggacttggagatgcaataagtcatgctaaaaattttgtt
ggaaatgaaccttttgcagtaatgcttggtgatgatatagttgataatgaagttccatgc
ttaaaacaattgataaattgctacgataaatataagacttcagtattaggcgttcaagaa
atctctgaatgtaatataccgaaatatggaataataaaagggatagagattgatgaagga
ctttataaggttagtgatatggtagaaaagcctaaaattgaagaggcaccatctaacata
gctattttaggtagatatataataacgccagatatatttgatatacttgaaagtaccaaa
ccaggaaaatcaggagaaattcaattgacagatgcgttaaaagaattaacaagacaagaa
gcagtatatgcttattgctttgaaggaaaaaggtatgatgttggtgataagttaggatac
cttcaagctaatatagcatttactttaaaacgcgatgatttaaaggatgattttataact
tacttgtcagatttaagagatagaagtgctaacctagatttgattcattaa

DBGET integrated database retrieval system