KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1754Help
Entry
Cbei_1754         CDS       T00547                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cbei_1754
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cbei_1754
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cbei_1754
Enzymes [BR:cbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cbei_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2026918..2028093
Genome map
AA seq 391 aa AA seqDB search
MKGRFNEFGGQYVPETVMNALIELEDAYNKVIDDKEFMDEYMYYLNYYTGRPSPLYYAEN
MTKDLGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKVIAETGAGQHGVATATVA
AKFGLECKIFMGEEDIKRQAMNVKKMELLGAEVVPVLNGVRTLNDAVTEAIRYWASNVED
TYYVLGTAAGPHPYPTMVRNFQRVIGDEARKQILELEGRLPDYILAPVGGGSNAIGIFYP
FIHDEEVNLIGVEAAGKGIETGEHAATITKKEKGILHGMLSYVLQDNDGGVLEAYSISAG
LDYPGVGPEHAYLAETNRAEYESITDEEAVRDGFMYLTRIEGIVPALESSHAVAYAKKLA
QTLSSDKIIIVNISGRGDKDMDAVLAYLGEK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtagatttaacgaatttggggggcaatatgttcctgaaactgtaatgaatgca
cttattgaacttgaagatgcttacaataaggtgatagatgataaagaatttatggatgag
tacatgtattatttaaactattatacaggaagaccaagtccactttattatgctgaaaat
atgacaaaagatttaggtggggcaaaaatttatttaaagagagaagatttaaatcatact
ggcgctcataaaattaataatgctttaggacaagtacttttagctaaaagaatgggtaag
aagaaagttatagcagaaacaggtgctggacaacatggcgttgcaacagctacagtagca
gcaaagtttggcttggaatgtaagatatttatgggagaagaagacataaagagacaagct
atgaatgttaagaagatggaacttttgggtgctgaagttgttccagtattaaatggagta
agaacattaaatgatgcagtaactgaagcgattagatattgggcctcaaatgtagaagat
acatactatgttttaggaacagctgctggtcctcacccatatccaactatggttaggaat
ttccaaagagttataggtgatgaagctagaaagcaaatattagagcttgaaggaaggcta
ccggattatatcttagctccagttggtggaggaagcaatgcaataggaatattttatcca
tttattcacgacgaggaagttaatcttattggagttgaagctgcaggtaaaggtattgaa
actggagaacatgcagcaaccattacaaagaaggaaaaaggaatcttacatggaatgttg
agttatgtacttcaggataatgatggtggagtgcttgaagcatattcaatatcagctggt
cttgattatccaggagttggacctgaacatgcatatttagctgaaactaatagagctgaa
tatgaaagcataacagatgaagaagctgtaagagatggatttatgtatttaacaagaata
gaagggatagtaccagcccttgaatcatctcatgctgtagcatatgctaaaaaattagca
caaacacttagcagcgataaaatcataattgtaaatatttcagggagaggagataaagat
atggatgctgtgcttgcatatctaggtgaaaaataa

DBGET integrated database retrieval system