KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1755Help
Entry
Cbei_1755         CDS       T00547                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00260  Glycine, serine and threonine metabolism
cbe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01130  Biosynthesis of antibiotics
cbe01230  Biosynthesis of amino acids
Module
cbe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cbei_1755
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cbei_1755
Enzymes [BR:cbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cbei_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB Ribosomal_S13_N
Motif
Other DBs
NCBI-ProteinID: ABR33927
JGI: Cbei1755
UniProt: A6LU97
Position
2028093..2028869
Genome map
AA seq 258 aa AA seqDB search
MNRIDLSFNKVKEENRKALIPFVTCGADFTVEETADLIVSLEKEGATIVEIGVPFRDPLA
DGPVIQNAYTKALQNGTKVKDVFRCVELIRGKSEVPIVLMVYFNVVYFTGVENFLRIAAK
SGVDGLIVPDVPLEERGDLDKICEDNCIYLIPLVARTSKDRIAAITKGAKGFVYCVSTNG
TTGERKTLDSGTHEYLEEVRKNVDIPMCIGFGISSKEVVKEVKDYCDGVIVGSAIVKRMA
EGKEAVIDFVKDLSDGLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagatttatcatttaataaagtaaaagaagaaaatagaaaagctttaata
ccttttgtaacatgtggggcagatttcacggttgaagaaacagctgatttgatagtgtct
ttagaaaaagaaggagcaactatagttgaaattggagtgccttttagagatcctcttgct
gatggcccagtaatacaaaatgcatatactaaagcgcttcaaaatggaacaaaagtaaaa
gacgtatttagatgtgtagaattaataaggggaaaatcagaagttccgattgtattaatg
gtgtatttcaatgttgtatactttactggagtagaaaatttcctgagaatagcggcaaaa
agcggtgtagatgggcttatagttccagatgtccctctagaggagaggggagatcttgat
aaaatttgtgaagataattgcatatacttaattcctctagtggctagaacttcaaaagat
agaatagcagcaataacaaaaggggcaaaaggttttgtatattgtgtatctacaaatgga
actacaggggaaagaaaaactttggattctggcactcatgaatatttagaagaagttaga
aagaacgtagatataccaatgtgcatcggttttggaatttcgtcaaaagaggtagtaaaa
gaagttaaagactattgtgatggggtaattgtaggtagtgcaatagtgaagagaatggca
gaaggcaaagaagcagtaatagatttcgtgaaagatttaagtgatggtcttaaataa

DBGET integrated database retrieval system