KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1755Help
Entry
Cbei_1755         CDS       T00547                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cbei_1755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cbei_1755
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cbei_1755
Enzymes [BR:cbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cbei_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2028093..2028869
Genome map
AA seq 258 aa AA seqDB search
MNRIDLSFNKVKEENRKALIPFVTCGADFTVEETADLIVSLEKEGATIVEIGVPFRDPLA
DGPVIQNAYTKALQNGTKVKDVFRCVELIRGKSEVPIVLMVYFNVVYFTGVENFLRIAAK
SGVDGLIVPDVPLEERGDLDKICEDNCIYLIPLVARTSKDRIAAITKGAKGFVYCVSTNG
TTGERKTLDSGTHEYLEEVRKNVDIPMCIGFGISSKEVVKEVKDYCDGVIVGSAIVKRMA
EGKEAVIDFVKDLSDGLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagatttatcatttaataaagtaaaagaagaaaatagaaaagctttaata
ccttttgtaacatgtggggcagatttcacggttgaagaaacagctgatttgatagtgtct
ttagaaaaagaaggagcaactatagttgaaattggagtgccttttagagatcctcttgct
gatggcccagtaatacaaaatgcatatactaaagcgcttcaaaatggaacaaaagtaaaa
gacgtatttagatgtgtagaattaataaggggaaaatcagaagttccgattgtattaatg
gtgtatttcaatgttgtatactttactggagtagaaaatttcctgagaatagcggcaaaa
agcggtgtagatgggcttatagttccagatgtccctctagaggagaggggagatcttgat
aaaatttgtgaagataattgcatatacttaattcctctagtggctagaacttcaaaagat
agaatagcagcaataacaaaaggggcaaaaggttttgtatattgtgtatctacaaatgga
actacaggggaaagaaaaactttggattctggcactcatgaatatttagaagaagttaga
aagaacgtagatataccaatgtgcatcggttttggaatttcgtcaaaagaggtagtaaaa
gaagttaaagactattgtgatggggtaattgtaggtagtgcaatagtgaagagaatggca
gaaggcaaagaagcagtaatagatttcgtgaaagatttaagtgatggtcttaaataa

DBGET integrated database retrieval system