KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_1759Help
Entry
Cbei_1759         CDS       T00547                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cbei_1759
   01230 Biosynthesis of amino acids
    Cbei_1759
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_1759
  Energy metabolism
   00680 Methane metabolism
    Cbei_1759
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cbei_1759
Enzymes [BR:cbe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cbei_1759
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cbei_1759
  Exosomal proteins of melanoma cells
   Cbei_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2036870..2037568
Genome map
AA seq 232 aa AA seqDB search
MIKLVLVRHGESLWNLENRFTGWTDVDLSENGLKEARRAGKILKKNGFVFDVAYTSVLKR
AIRTLWIILYEMDLAWIPVFKSWRLNERHYGALQGLNKAETAKKYGEEQVHKWRRFVNVK
PPELTKEDTRYPGNEYKYKDLNEEQIPLTENLADTERRVLEEWRGNIAKDLKEGKRVIIS
AHGNTLRALVKYLDDIPADNVANLNIPTGIPLVYELDEKLKPITHYYLSDKE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattagtactagtaaggcatggagaaagtctttggaatttggaaaatagattt
actggatggacagatgtggatttgtcagagaatggattaaaggaagcaagaagagcagga
aaaatacttaagaaaaatggttttgtatttgatgtagcttatacatcagttctaaaaaga
gcgataagaacattatggataatattatatgagatggatttggcatggattcctgttttt
aaatcatggagattaaacgagagacattatggagctttacaaggattaaataaagcagaa
actgctaaaaaatatggagaagagcaagttcataaatggagaagatttgtaaatgtaaaa
cctccagaattgactaaagaggataccagataccctgggaatgaatataagtacaaggat
ttaaatgaagaacaaatacctttaacagaaaaccttgctgatactgaaagacgtgtatta
gaggaatggagaggaaatatagctaaagatttgaaagaaggtaaaagagtgataatatct
gctcatggaaatacattaagagctttagttaaatatttagacgatattccagctgataat
gtagctaatttgaatattccaacaggaatacctttagtatatgaattggatgaaaagtta
aagccaattactcattattacctatcagataaggaataa

DBGET integrated database retrieval system