KEGG   Clostridium beijerinckii: Cbei_1759Help
Entry
Cbei_1759         CDS       T00547                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cbe  Clostridium beijerinckii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cbei_1759
   01230 Biosynthesis of amino acids
    Cbei_1759
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_1759
  Energy metabolism
   00680 Methane metabolism
    Cbei_1759
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cbei_1759
Enzymes [BR:cbe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cbei_1759
Exosome [BR:cbe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cbei_1759
  Exosomal proteins of melanoma cells
   Cbei_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2036870..2037568
Genome map
AA seq 232 aa AA seqDB search
MIKLVLVRHGESLWNLENRFTGWTDVDLSENGLKEARRAGKILKKNGFVFDVAYTSVLKR
AIRTLWIILYEMDLAWIPVFKSWRLNERHYGALQGLNKAETAKKYGEEQVHKWRRFVNVK
PPELTKEDTRYPGNEYKYKDLNEEQIPLTENLADTERRVLEEWRGNIAKDLKEGKRVIIS
AHGNTLRALVKYLDDIPADNVANLNIPTGIPLVYELDEKLKPITHYYLSDKE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattagtactagtaaggcatggagaaagtctttggaatttggaaaatagattt
actggatggacagatgtggatttgtcagagaatggattaaaggaagcaagaagagcagga
aaaatacttaagaaaaatggttttgtatttgatgtagcttatacatcagttctaaaaaga
gcgataagaacattatggataatattatatgagatggatttggcatggattcctgttttt
aaatcatggagattaaacgagagacattatggagctttacaaggattaaataaagcagaa
actgctaaaaaatatggagaagagcaagttcataaatggagaagatttgtaaatgtaaaa
cctccagaattgactaaagaggataccagataccctgggaatgaatataagtacaaggat
ttaaatgaagaacaaatacctttaacagaaaaccttgctgatactgaaagacgtgtatta
gaggaatggagaggaaatatagctaaagatttgaaagaaggtaaaagagtgataatatct
gctcatggaaatacattaagagctttagttaaatatttagacgatattccagctgataat
gtagctaatttgaatattccaacaggaatacctttagtatatgaattggatgaaaagtta
aagccaattactcattattacctatcagataaggaataa

DBGET integrated database retrieval system