KEGG   Clostridium beijerinckii: Cbei_1843Help
Entry
Cbei_1843         CDS       T00547                                 

Definition
1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cbe  Clostridium beijerinckii
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cbei_1843
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Cbei_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2133712..2134614
Genome map
AA seq 300 aa AA seqDB search
MINTITLNPSLDYIVKVDSFKVDSLNRTEEENIYAGGKGINVSIVLKNLGVANTALGYVA
GFTGDEILRQIQSHGVNCDFIKLKSGFSRINVKLKSDGETEINGSGPAITDEELNLLHEK
LLHLTKGDYLILSGSIPNSVPDNIYESIMNSLLDKGVEFIVDATKDLLLKVLKYKPFLIK
PNHHELAEMFNVELKDDEDIIKYGRKLQEMGAKNVLISMAGDGAILLPENGDPIKRAVPK
GILKNSVGAGDSMVAGFLCGYLKNKNIEEAFKMGIATGSASAFSEELATKEQVYELLKQI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattaatacaataactcttaatccttctttagattatattgttaaagttgattcattt
aaagttgattcactaaatagaactgaagaagaaaatatttatgcgggtggtaaaggaatt
aacgtatcgatagttcttaaaaatctaggggtagctaacacagctcttggatatgttgct
gggtttactggagatgaaattctaagacaaatacaaagccatggtgtaaactgtgatttt
ataaaattaaaaagtggattttctagaataaacgtgaaacttaaaagtgatggagaaaca
gaaattaatggatctggaccagcaataactgatgaagagttaaacctcttacatgaaaaa
cttttgcatctaacaaaaggtgattatttaatattatctgggagtataccaaatagtgtg
ccggataatatatatgaaagcattatgaacagcttattggataagggagtagagttcata
gttgatgcaacaaaagatttgctattaaaggtattaaaatataaaccgtttttgataaaa
ccaaatcatcatgaacttgcagaaatgtttaatgtagaattaaaagatgatgaagacata
attaaatatggtagaaaacttcaagaaatgggagcaaaaaatgttcttatctcaatggca
ggggatggcgcaattctactacctgaaaatggggatcctataaaaagagctgttccaaaa
ggaatacttaaaaattcggttggggctggagattcaatggtagctggtttcttatgcgga
tatttaaaaaacaaaaatatagaagaagcgttcaagatgggaattgctacaggaagtgca
agtgctttctcagaagaattggcaacaaaagaacaagtatatgaactattaaagcaaatt
taa

DBGET integrated database retrieval system