KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_2121Help
Entry
Cbei_2121         CDS       T00547                                 

Definition
alpha/beta fold family hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cbei_2121
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Cbei_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2472213..2473268
Genome map
AA seq 351 aa AA seqDB search
MLISLIVQLFVNINIFNIKVNAAEINSNLDEIYISESNYNEDMKGKVEPYIKSKLESGYI
DGDKDVKLYYEKYNIENAKANIVISHGYTESLEKYHELIYYFLKEGYNVFGIEHRGHGRS
GTLGIADKTQVNVEKFDQYVTDFKKFMDEVVMPNNQGKKVLLFAHSMGGTIGTKFIEDYP
DYFDAAVLSAPMFEVNTGNIPKFLADIIVEFEVAIGNGGNYVLGKKAYTPEYKENEIGTS
SLNRYKYSHDIVANNKELQRGGASYNWTKEAFDTTKEIIKPENASKVEIPILLFQADNDT
YVKAEGQNKFASSAKNCEIEKIENSRHEIYLEKDEIQKPYLNELLDFYDKV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctaatttcacttatagtacagctatttgtcaatataaatatttttaatattaaagtt
aatgctgctgaaataaatagtaatttagatgaaatatatatatctgaatctaattacaat
gaagatatgaaaggtaaagtcgaaccatatataaaaagtaaactggaatctggatatata
gatggagataaggacgttaaattgtactatgaaaaatacaatatagaaaatgcaaaggct
aatatagtaatatctcatggatatactgagagtttagagaagtatcatgaattaatatac
tattttttaaaggaagggtataatgttttcggaattgaacatagaggccatggtagatct
ggtacacttggaatagccgataaaacccaagtaaatgtagaaaaattcgatcaatatgta
actgattttaaaaaatttatggatgaagttgttatgccaaataatcaaggtaaaaaggta
ttattgtttgctcattcaatggggggaactattggaacaaaattcatagaggattaccca
gattattttgatgctgcggtattaagtgctcccatgtttgaagttaacactggaaatata
ccaaaatttctagctgatattatagtagaatttgaagttgctattggtaatggtggaaat
tacgttttaggtaagaaagcatatacaccagagtataaggaaaatgagattgggacaagt
tctttgaatcgttataaatatagtcatgatatagtagctaataacaaagaacttcaaaga
ggtggtgctagctataattggacaaaagaagcctttgatacaacgaaggaaattataaaa
ccagaaaatgcatcgaaagtagaaattccaatattattatttcaagctgataatgacact
tatgtaaaggcagaaggacaaaataaattcgcaagtagcgcaaagaattgcgaaatagaa
aagatagaaaactctagacatgaaatatatttagaaaaagatgaaattcaaaaaccgtat
ttaaatgaattactagatttttatgataaagtataa

DBGET integrated database retrieval system