KEGG   Clostridium beijerinckii: Cbei_2383Help
Entry
Cbei_2383         CDS       T00547                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cbe  Clostridium beijerinckii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cbei_2383
   00051 Fructose and mannose metabolism
    Cbei_2383
Enzymes [BR:cbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Cbei_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2749301..2750626
Genome map
AA seq 441 aa AA seqDB search
MREYFENVSKINYEGANSKNPYSFKYYNPDEIIGDKAMKEHLRFALSYWHTLTATGADPF
GVGTMIRPWDSETNEMDLAKARMEAAFELMDKLNIEYFCFHDRDIAPEGKTLQETNKNLD
EIVALCKSLMKKYNKKLLWGTANCFTNPRYVHGAGTSCNADVFAYAAAQIKKAIEITKEL
DGENYVFWGGREGYETLLNTDMGLELDNFARLLQMAVDYAKEIGFTGQFLIEPKPKEPTK
HQYDFDAATVLGFLKNYNLDKYFKVNIEANHATLAQHTFQHELHFARINKFLGSIDANQG
DPLLGWDTDQFPTNIYDATLAMYEILKNGGLAPGGVNFDSKVRRASFEKEDLFLAYIAGM
DTFAKGLRVAYKLLENGDLEDFIKEKYSSFTEGIGKEIVEGKVGFKELEAYALNNNPIIN
KSGRQELLESIVNQYIFEDHK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatactttgaaaatgtttcgaaaataaattacgagggggcaaattctaaaaat
ccatattcatttaaatattataatccagacgaaattattggggataaagcaatgaaagaa
catctaagatttgccttatcttattggcacacattaacagctacaggagcagatccattt
ggtgttgggactatgattcgtccatgggatagcgaaacaaatgaaatggatttagctaaa
gcaagaatggaagcagcatttgaattaatggataagctaaacatagaatatttctgcttc
catgatagagatatagcaccagaaggaaaaacattacaagaaactaataaaaatttagat
gagatagttgcgttgtgtaaaagtttaatgaaaaagtataataaaaaacttttatgggga
acagctaactgttttactaatccaaggtatgttcatggtgcaggtactagctgtaatgcg
gatgtatttgcttatgcagcagcacaaattaaaaaagcaattgaaataacaaaagagcta
gatggagaaaactatgttttttggggtggacgtgaaggatatgaaactctattaaataca
gatatgggattagaattagacaactttgctagattacttcaaatggctgttgattatgca
aaagaaataggatttacaggacaatttttaatagagccaaagccaaaggaaccaacaaag
caccaatatgattttgatgcagcaacagttttaggattccttaaaaattataaccttgat
aagtattttaaagttaacattgaagcaaatcatgctactttggcacaacacacattccaa
catgaacttcattttgcaagaatcaataaattcttaggcagcatagatgctaatcaagga
gatccattacttggatgggatacagatcagttcccaacaaatatatatgatgctacatta
gctatgtatgaaatccttaaaaatggagggcttgcaccaggtggtgttaactttgattct
aaagttagaagggcatcatttgagaaagaagatttattcctagcttatatagcaggaatg
gatacatttgctaaaggattgagagttgcttataaacttttagaaaatggtgatttagaa
gactttataaaggaaaaatattcaagctttacagagggaatcggtaaagaaattgttgaa
ggaaaagttggctttaaagaattagaagcatatgcgttaaacaataaccctataataaat
aaatctggaagacaagagctgttagaatctatagttaatcaatatatatttgaggatcat
aaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system