KEGG   Clostridium beijerinckii: Cbei_2383Help
Entry
Cbei_2383         CDS       T00547                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cbe  Clostridium beijerinckii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cbe00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbe00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2749301..2750626
Genome map
AA seq 441 aa AA seqDB search
MREYFENVSKINYEGANSKNPYSFKYYNPDEIIGDKAMKEHLRFALSYWHTLTATGADPF
GVGTMIRPWDSETNEMDLAKARMEAAFELMDKLNIEYFCFHDRDIAPEGKTLQETNKNLD
EIVALCKSLMKKYNKKLLWGTANCFTNPRYVHGAGTSCNADVFAYAAAQIKKAIEITKEL
DGENYVFWGGREGYETLLNTDMGLELDNFARLLQMAVDYAKEIGFTGQFLIEPKPKEPTK
HQYDFDAATVLGFLKNYNLDKYFKVNIEANHATLAQHTFQHELHFARINKFLGSIDANQG
DPLLGWDTDQFPTNIYDATLAMYEILKNGGLAPGGVNFDSKVRRASFEKEDLFLAYIAGM
DTFAKGLRVAYKLLENGDLEDFIKEKYSSFTEGIGKEIVEGKVGFKELEAYALNNNPIIN
KSGRQELLESIVNQYIFEDHK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatactttgaaaatgtttcgaaaataaattacgagggggcaaattctaaaaat
ccatattcatttaaatattataatccagacgaaattattggggataaagcaatgaaagaa
catctaagatttgccttatcttattggcacacattaacagctacaggagcagatccattt
ggtgttgggactatgattcgtccatgggatagcgaaacaaatgaaatggatttagctaaa
gcaagaatggaagcagcatttgaattaatggataagctaaacatagaatatttctgcttc
catgatagagatatagcaccagaaggaaaaacattacaagaaactaataaaaatttagat
gagatagttgcgttgtgtaaaagtttaatgaaaaagtataataaaaaacttttatgggga
acagctaactgttttactaatccaaggtatgttcatggtgcaggtactagctgtaatgcg
gatgtatttgcttatgcagcagcacaaattaaaaaagcaattgaaataacaaaagagcta
gatggagaaaactatgttttttggggtggacgtgaaggatatgaaactctattaaataca
gatatgggattagaattagacaactttgctagattacttcaaatggctgttgattatgca
aaagaaataggatttacaggacaatttttaatagagccaaagccaaaggaaccaacaaag
caccaatatgattttgatgcagcaacagttttaggattccttaaaaattataaccttgat
aagtattttaaagttaacattgaagcaaatcatgctactttggcacaacacacattccaa
catgaacttcattttgcaagaatcaataaattcttaggcagcatagatgctaatcaagga
gatccattacttggatgggatacagatcagttcccaacaaatatatatgatgctacatta
gctatgtatgaaatccttaaaaatggagggcttgcaccaggtggtgttaactttgattct
aaagttagaagggcatcatttgagaaagaagatttattcctagcttatatagcaggaatg
gatacatttgctaaaggattgagagttgcttataaacttttagaaaatggtgatttagaa
gactttataaaggaaaaatattcaagctttacagagggaatcggtaaagaaattgttgaa
ggaaaagttggctttaaagaattagaagcatatgcgttaaacaataaccctataataaat
aaatctggaagacaagagctgttagaatctatagttaatcaatatatatttgaggatcat
aaataa

DBGET integrated database retrieval system