KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_2540Help
Entry
Cbei_2540         CDS       T00547                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cbei_2540 (folE)
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cbei_2540 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2948190..2948783
Genome map
AA seq 197 aa AA seqDB search
MPKKIDTKKIEECIREIIVALGDDPNREGLLDTPKRVSKMYEEVFQGMTLSNREIAEAFG
TTFENEDYDSETHNNMVVVKDIPIHSYCEHHLALMYNMKVTVVYIPKDKIIGLSKISRIA
DMVGRRLQLQERIGTDIAEIVSMVTKSSDVGVLITGEHGCMTSRGIKKPGTLTTTTTFTG
KFQTNDLLRQEALLIMK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaagatagatacaaaaaagatagaggaatgtataagagaaattattgttgct
ttaggagatgatcctaatagggaaggattactagatacacctaaaagggtatcaaaaatg
tatgaagaagtttttcaaggaatgacactttcaaacagagaaatagcagaagcgtttgga
accacatttgagaatgaagattatgattcagaaactcataataatatggttgtggttaag
gatataccaattcatagttattgtgaacatcacttagcgcttatgtataatatgaaggtt
acagtagtatatataccaaaagataagataattggtcttagtaaaatttcaagaattgca
gatatggttgggagaagacttcaacttcaagaacgtattggaacagatatagcagaaata
gtttctatggttacaaaaagtagtgatgttggtgtacttataactggagagcatggatgt
atgacttcaagaggaataaaaaaacctggaacattgactacaacaactacttttacagga
aaatttcaaaccaatgatttactaagacaagaagctttactaattatgaaataa

DBGET integrated database retrieval system