KEGG   Clostridium beijerinckii: Cbei_2830Help
Entry
Cbei_2830         CDS       T00547                                 

Definition
glycoside hydrolase
Orthology
K01183  
chitinase [EC:3.2.1.14]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cbei_2830
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Cbei_2830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3294950..3296749
Genome map
AA seq 599 aa AA seqDB search
MKHVTLKKFLAFFVVFLLTFTQITLMPKAAEKSDKKNVVVYFPNWGTYNTAHSSISVDQL
PWDKVTVINHAFFEVDSSFKLNSTDSYADFDKSFPHSEGWDADKLRGHMGEYKYYKSQYP
SVKVLISVGGWTRGANFHAMASSSSSRAVFINSVVDFLKKYPFIDGIDIDWEFPGIDRKA
DPNDQFDKGCPGGSEDKQNFTSLLREIRKAYNDNGLSNKMLTIAAPSGYDKAQYTEPNVY
AQYLDFINVMTYDMHGAWETTTNHHAAIYPNPNDPSGTSPVDIKNKYNTDSAMRLYRDTY
NIPASKLNVGTPFYSRGWKNVVNNGGSLPGLFASANGAPVGTWDNAQSPGGQNPYFKMKE
LEKTSGYVKYRDPYAKVPYLYNASQGIMYTYEDEESLTERCDYVLNNGYGGMIAWEVSGD
DPNGFPLTTLMANKLSGGSNPTTPTDPTNPTDPTNPTDPTNPSNPGTSYPAWDSSKVYVN
GDIVSYNNNNYKAKWWTQGDKPGASDVWELIGAATPTNPSNPITPTTPTNPSNPTDPTNP
SDPGTSYPAWDSSKAYVNGDIVSYNNNNYKAKWWTQGDKPGASDVWELIGAATQSNPKY
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacacgtaacattaaaaaaatttcttgctttttttgtagtctttctacttacattc
acgcaaataacactaatgcctaaagcagcagaaaaatctgataaaaaaaatgttgtagtt
tattttcctaattggggtacctacaatacagctcacagcagtatatctgttgatcaatta
ccttgggacaaggtcactgtaatcaatcatgcattctttgaagtagattcaagctttaaa
ctcaattctactgattcttatgcagattttgataaatctttcccacattctgaaggttgg
gatgcagataaacttagaggacacatgggtgaatataagtattacaaatctcaatatcca
agtgtaaaggtgcttatatcagtaggtggatggacaaggggtgctaatttccatgcaatg
gcatcaagttctagttctcgtgctgtgttcataaacagtgtagtagattttctaaaaaaa
tatccattcatagatggaattgatatcgactgggaattccctggtattgatagaaaagcc
gatccaaacgaccaatttgataaaggttgcccaggtggatcagaggacaaacaaaacttt
acttcacttcttcgtgaaatacgtaaagcttacaatgataatggattgtctaataaaatg
cttacaatagcagcaccatctggatatgataaagcacaatatactgaacctaacgtttat
gctcaatacttagattttataaacgttatgacttatgatatgcacggggcttgggaaaca
acgactaatcatcatgctgcaatatatccaaatcctaatgatccatctggaacttctcct
gtagatataaaaaataaatataatactgattcagcaatgagattgtacagggacacttat
aatatacctgcaagcaaactaaatgttggaacaccattctattcaagaggatggaaaaat
gttgtgaacaatggtggaagcctacctggattatttgcttctgcaaatggtgcaccagta
ggtacatgggataatgcacaatctccaggtggacaaaacccttattttaaaatgaaggaa
ttggaaaaaacatcaggttacgtaaaatatagagatccatatgctaaagttccttatcta
tataatgcatcacaaggaattatgtacacatatgaagatgaagaatctcttacagaaaga
tgtgattacgtattaaataacggttatggcggaatgattgcttgggaagtttcaggagat
gacccaaatggattcccattaactactttaatggcaaataaactttctggcggaagtaat
ccaacaaccccaactgacccaacaaatccaactgacccaacaaatccaacggatccaaca
aacccaagtaatcctggtacttcttatcctgcatgggatagtagtaaagtctatgtaaat
ggagatattgtttcttataacaataacaattacaaagcaaaatggtggactcaaggtgat
aaacctggtgcttctgatgtttgggaattaattggagccgctacaccaactaacccaagt
aatccaattacgccaacaaccccaactaatccaagtaatccaacggatccaacaaaccca
agtgatcctggtacttcttatcctgcatgggatagtagtaaagcttatgtaaatggagat
attgtttcttataacaacaacaattacaaagcaaaatggtggactcaaggtgataaacct
ggtgcttctgatgtttgggaattaattggagccgctacacaaagtaatccaaaatactaa

DBGET integrated database retrieval system