KEGG   Clostridium beijerinckii: Cbei_3041Help
Entry
Cbei_3041         CDS       T00547                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cbe  Clostridium beijerinckii
Brite
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cbei_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3546169..3546813)
Genome map
AA seq 214 aa AA seqDB search
MKKRGLKLFLASLMCCTLALSVVNVNAYAAATDYWQNWTDGGGTVNAVNGSGGNYSVNWS
NCGNFVVGKGWNAGSYTRVINYNAGQFAPSGNGYLSLYGWTRNSLIEYYVVDDWGTYRPT
GNYKGTVTSDGGTYDIYTATRTNAPSIDGVTTFQQFWSVRQSKRSIGTNNTITMKNHADA
WGSKGMALGSSWAYQMIATEGYQSSGSANVTVWE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaggattaaaattatttttagcgtcattaatgtgttgcactcttgcactt
tctgttgtaaacgtaaacgcatatgcagcagcaacagactattggcaaaattggacagac
ggtggtggaacagtaaacgcagttaatggatctggcggtaattatagcgttaattggagt
aactgcggcaactttgttgttggtaaaggctggaatgctggatcatacactagagtaata
aactataatgctggtcaatttgcaccttcaggtaatggttatttatcattatatggatgg
acaaggaactcacttatagaatattacgttgttgatgactggggaacttataggccgact
ggaaattacaagggtactgtaactagtgatggaggcacatacgatatatatactgctact
agaactaatgcaccttctatcgatggagttacaactttccaacagttctggagtgttaga
caatctaagagatcaattggtactaataataccattactatgaaaaatcacgctgatgca
tggggaagtaaaggaatggctttaggttctagttgggcttatcagatgatagcaacagaa
ggatatcaaagtagtggaagtgctaatgtaacagtatgggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system