KEGG   Clostridium beijerinckii: Cbei_3864Help
Entry
Cbei_3864         CDS       T00547                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cbe  Clostridium beijerinckii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cbei_3864
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_3864
  Lipid metabolism
   00071 Fatty acid degradation
    Cbei_3864
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cbei_3864
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cbei_3864
   00626 Naphthalene degradation
    Cbei_3864
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cbei_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4435544..4436509
Genome map
AA seq 321 aa AA seqDB search
MDVFFMKLMKAIQVSKPGSAFELIQTEIPEPTKNQVRIKILACGVCHGDALVKEGGNYPG
LSYPRIPGHEIIGVVDKIGSDVTGYELGQRVGVGWPAGITYDGGFAEYMVTTSSELVSIP
EELNEVEGAPLLCAGVTTFDALKNSGANPGDVVAIQGVGGLGHLAIQYAKNIGFKTVAIS
RGSDKKELAEKLGANIFIATEEQDAAKELQKLGGAKVILITAPSSKAVSELLSGLGFDGK
IIIVAGINDPIQIFPNQLLVGRQSIQGWLATDANARKDTINFSILTNVHSIVETFPLEQI
NSAYEKMMTAKVHFRAVLTME
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgttttttatgaaattaatgaaagcaattcaagtaagtaaacctggctcagct
tttgagttaatacaaacggaaattccagaaccaactaaaaatcaagtaaggataaaaatt
ctagcttgtggtgtatgccatggagatgcattagtaaaagaaggaggtaattatcctggg
ctttcataccctcgtatccctggtcatgaaattataggtgttgtagacaagattggctca
gatgttactggttatgaattaggacaacgtgttggtgtaggctggcctgctggtataaca
tatgatggaggtttcgctgaatacatggtaactacttcttctgaattagtaagtatacca
gaagaattaaatgaagtagaaggtgcacctcttctttgcgctggtgtgactacttttgat
gctttaaaaaattctggtgcaaatcctggagatgtagttgcaatacaaggcgttggaggc
cttggtcatttagctatccaatatgctaagaatattggctttaagactgttgctatttca
aggggatcagataaaaaagaacttgctgaaaaattaggagctaacatatttatagctact
gaagaacaagatgcagcaaaggaacttcaaaaattggggggagctaaagttatcctcata
actgctccaagcagcaaggctgtatcagaacttttaagtggtcttggatttgatggaaaa
ataataattgttgctggaataaatgatccgattcaaatctttcctaatcaattattggtt
ggaagacaaagtatacaaggatggttagccacagatgctaatgccagaaaagatactata
aattttagtattctaacaaatgtacactcaatagttgaaacttttccactagaacaaata
aattcagcgtatgaaaaaatgatgactgctaaggttcactttagagctgttttaactatg
gaataa

DBGET integrated database retrieval system