KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4359Help
Entry
Cbei_4359         CDS       T00547                                 

Definition
(GenBank) glycoside hydrolase, family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00052  Galactose metabolism
cbe00561  Glycerolipid metabolism
cbe00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cbei_4359
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cbei_4359
   00600 Sphingolipid metabolism
    Cbei_4359
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cbei_4359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: ABR36469
JGI: Cbei4359
UniProt: A6M1I9
Position
5025619..5026941
Genome map
AA seq 440 aa AA seqDB search
MKITFMGAGSTVFARNVLGDCMCTEVLRDSEIALYDIDEERLKESEIILNAINKNINNGR
ANIKCFLGVENRKLALKDATFVVNAIQVGGYDPCTITDFEIPKKYGLKQTIADTMGIGGI
MRALRTIPVMADFAKDMEEVCPDAYFLNYTNPMAMLTGFMQRFTKVKTIGLCHSVQVCSE
HLLKDLGMEDKLEGRKELIAGINHMGWLLEIYDKAGNDLYPEIRKRAELKNYGEEKHKDM
VRYEYIKHLGYYCTESSEHNAEYNPFFIKSKYPELIDKFNIPLDEYPRRCIEQIDGWQKE
KNEILRDGKVTHERSKEYASYIMEAIVTNTPYKIGGNVINTGLIDNLSTDACVEVPCMVD
AMGIHPTHVGKLPTQLAAMNMSNINSQLLTIEAAVTKDRHKIYQAAMMDPHTAAELSIDD
IIKMCDEMIESHGEYMNDFK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacatttatgggagctggaagtactgtatttgctagaaatgtgttaggtgat
tgtatgtgcacagaagtactacgagatagtgaaattgcactttatgatattgatgaggaa
agattaaaggaaagtgaaataatcctaaatgcaatcaacaaaaatataaataatggcagg
gctaatataaaatgttttttaggcgttgaaaatagaaagctagcactcaaagatgcaact
tttgtggttaatgctattcaggttggaggatatgatccttgcacaatcacagatttcgaa
attcctaagaaatatggtttaaaacaaactattgcagatacaatgggaattggtggaatt
atgagagctctaagaacaattcctgtaatggctgactttgcaaaagatatggaagaagta
tgccctgatgcatatttcttaaactatactaatccaatggctatgcttacaggttttatg
caacgcttcaccaaagtaaaaacaattggactttgtcatagtgtacaagtatgttcagaa
catttgttaaaagatttaggcatggaagataaattagaaggtagaaaagaattaattgct
ggtattaatcatatggggtggctattagaaatatatgataaagcaggaaatgatttatac
cctgagattagaaaaagagctgagctaaaaaattatggtgaagaaaaacataaagacatg
gttcgttatgaatacatcaaacaccttggatactattgcactgagtcaagcgaacataat
gcagaatataatccttttttcattaaatcaaaatatccagaactaattgataaatttaat
atccctctagatgaatatccaagaagatgtattgaacaaattgatggctggcaaaaagaa
aaaaacgaaatattacgtgatggtaaagttacgcatgaacgttcaaaagaatatgcatct
tatattatggaggcaattgtgactaatactccttataagattggtggtaatgtaataaat
accgggctaattgataatttatcaactgatgcctgtgtagaagttccttgtatggtcgac
gctatgggaattcacccaactcatgtaggaaaacttccaactcaacttgctgctatgaat
atgagtaatataaattctcagctattgacaattgaagcagcagttacaaaagatagacat
aaaatctatcaagctgccatgatggatccacatacagctgccgaattatctattgatgac
attataaaaatgtgtgatgaaatgatcgaatctcacggagaatatatgaatgactttaaa
taa

DBGET integrated database retrieval system