KEGG   Clostridium beijerinckii: Cbei_4441Help
Entry
Cbei_4441         CDS       T00547                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cbe  Clostridium beijerinckii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbe00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cbe00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cbe00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5125250..5127346)
Genome map
AA seq 698 aa AA seqDB search
MSKYIKINENNLNIVLEVTKDRDIRLLHFSYLPFEQFNKLSEDEKEKCRLLELQFTGENQ
LNHRGVKHTGTLPGHRIIYESHNDEILKEGRRITINLVDNITKIEAKVIFQFYNDLQIVR
TWSILENKGERSVGIEYITSFTLTGIDRGGVLDRENKMKIYIPHNEWCGEGMWEQYSLKD
VGIFHVEDESTNRLLVSNTGNWSTCQYAPLGFIENTEISNGYMWQIEHNGSWNWEISDIM
HMLYLKLSGPSEAENHFWKELKPNESFETVQVAVTSISGGLQAGIEVMTKYRRRIRREND
DNKRLPVIFNDYMNCLSGDPTTEKLIPLINAASLAGCEYFCIDCGWYSDGPWWDGVGEWL
PSKERFKNGIKEPLDYIREKGMIPGLWLELEVMGINCSLADKLPDDWFFMRHGKRIKDHS
RYQLDYRNPEVRKFATGIIKRVVEEYGVGYIKMDYNINMGIGTDNKADSAGEGLLGHNRA
YLAWLDEIFKRYPDLVIENCGSGGLRMDYALLQRHSIQSSSDQTDYRKNAAIAAAVPSLV
TPEQCAVWSYPLRDGDKEEVICNMVNSMLCRIHQSGHLAEINNESFKYIQEGIKYYKSIR
HDIPNGIPFWPIKMPSLDDEWIAYGLLCSRVCYLALWRMQSENDIIEIPLERFNGENISV
KMGYPEDVDLSWNINKIKNILIIRNKHNYSGRILEIRW
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatatataaaaattaatgagaataatttaaatattgtattagaagtaactaaa
gatagagatataagattgctacatttttcatatcttccttttgaacagtttaataaatta
agtgaagatgaaaaagaaaaatgtagattattagaattgcaatttacaggagaaaatcaa
ttaaatcatagaggagtaaaacatacaggaactctgcccggacataggataatttatgag
agtcataatgatgaaattctaaaagaaggaagaagaattactattaacttagttgacaat
attacaaaaattgaagcaaaagtaatatttcaattttataatgatttacaaatcgttaga
acatggagcattttagaaaataaaggtgaaagaagtgttggaatagagtatataacctca
tttactttaactggtattgatagaggcggagtattagacagagaaaataaaatgaagata
tatattcctcataatgagtggtgtggtgaaggaatgtgggaacaatattcattaaaagat
gttggaatattccatgtggaagacgaatcaacaaatagattgttagtttctaatacagga
aattggtcaacctgtcagtatgcgcctctaggatttatagaaaatacagaaataagtaat
ggttacatgtggcaaatagagcataatggctcatggaattgggaaattagtgacataatg
catatgctatatttaaaattaagcggaccttcagaagcagaaaatcatttctggaaagaa
ctaaaacccaatgaaagctttgaaacagtacaagtcgcagttacaagcataagtggagga
ttgcaagctggaatagaagttatgactaaatataggcgtagaataagaagagaaaatgat
gataataaaagattaccagttatttttaatgattatatgaattgtttatctggtgatcct
actacagaaaaactaattcctcttattaatgctgcatcactagctggttgtgagtatttt
tgcatagattgtggatggtatagtgatggaccttggtgggatggtgttggagaatggctg
ccatctaaagagagatttaaaaatggtattaaagaacctctagactatataagagagaaa
ggaatgattccagggctttggcttgaacttgaggtaatggggataaattgttcattagca
gacaaattacctgatgattggttctttatgaggcatggaaagagaataaaggatcattca
agatatcaattagattatagaaatccagaagttagaaagtttgcaactggaattataaag
agagttgtagaagagtatggtgttggatatataaagatggattataatattaatatgggg
attggtactgataacaaagctgatagtgcaggtgaaggactattaggtcataatagagca
tatttagcttggttagacgaaatatttaaaagatatcctgacttagttattgagaattgt
ggtagtggtggacttagaatggattatgccctattgcaaagacatagtatacaatcaagc
agtgaccaaacagattatagaaaaaatgcagcaattgcagcagcggtaccatctttagtt
actccagaacaatgtgcagtttggtcttatccattgcgagatggggataaagaagaagta
atatgtaacatggtaaattctatgttatgtagaattcatcagagtgggcatttagcagaa
ataaataatgaatcctttaaatatatccaagaaggaattaaatattataaaagcatcaga
catgatataccaaatggaataccattttggccaataaaaatgccatctctggacgatgaa
tggatagcatatggactgttatgtagtagagtatgttatcttgctttatggaggatgcaa
agtgaaaatgatattatagagattccattggaaagatttaatggagaaaatatatctgta
aaaatggggtatcctgaagacgtagatttaagctggaatataaataaaattaagaatatt
ttaatcattagaaataaacataattatagtggaagaattctcgagataaggtggtga

DBGET integrated database retrieval system